The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 30

Prints on letter paper in black and white. No answers are printed on the student sheet.

Exodus 30 · Grade 2

Prayers Like Sweet Smoke

Name Date

Read the Story

God told Moses to make a small gold altar. Aaron would burn sweet incense on it every morning and every evening. The smoke smelled good and went up to God. The Bible says our prayers are like incense to God.

Each person who was counted gave the same small gift of money. Rich people did not give more. Poor people did not give less. Everyone mattered the same to God.

God told Moses to make a big bowl for water. The priests washed their hands and feet in it before they served God. God also gave a recipe for holy oil and holy incense, just for worship.

Memory Verse

“Aaron shall burn incense of sweet spices on it every morning. When he tends the lamps, he shall burn it.”

Exodus 30:7 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. When did Aaron burn incense?

  2. What does the Bible say our prayers are like?

    IncenseOnly for worshipTheir hands and feet

  3. Did rich people give more than poor people?

  4. What did the priests wash in the bowl?

    Only for worshipNo, everyone gave the sameTheir hands and feet

  5. What were the holy oil and incense for?

    Their hands and feetIncenseOnly for worship

Word Search

Find and circle each word. Words go across and down.

LMSAEHIMWCICFSWEETSTNPNKPNGLNGCHWASHCADFEFVLOPEMFVNELRRUFPUESEGALHANDSETYKSSWATER
  • INCENSE
  • HANDS
  • WATER
  • SWEET
  • PRAY
  • WASH
  • FEET
  • LAMP

Prayer

Dear God, thank You for today's Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • How can you treat everyone fairly?
  • When do you need a clean heart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.