The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 30

For teachers and parents. Prints separately from the student sheets.

Exodus 30 · For teachers and parents

Answer Key: Incense, Washing and Holy Oil

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolSweet Smell to God

incensewater and jarhandlampstand

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenPray and Wash

INCENSE → picture 3WATER → picture 1HANDS → picture 4LAMP → picture 2

Grade 1Ready to Serve

Incense every morning → picture 2Half a shekel each → picture 4A bronze bowl for washing → picture 1Holy anointing oil → picture 3

Order:

1. God said, You shall make an altar to burn incense on2. God said, When you take a census of the children of Israel3. God said, You shall also make a basin of bronze4. God said, You shall make it into a holy anointing oil

Grade 2Prayers Like Sweet Smoke

  1. When did Aaron burn incense? Every morning and every evening
  2. What does the Bible say our prayers are like? Incense (circle)
  3. Did rich people give more than poor people? No, everyone gave the same.
  4. What did the priests wash in the bowl? Their hands and feet (circle)
  5. What were the holy oil and incense for? Only for worship (circle)
LMSAEHIMWCICFSWEETSTNPNKPNGLNGCHWASHCADFEFVLOPEMFVNELRRUFPUESEGALHANDSETYKSSWATER

Grade 3The Incense Altar and the Basin

  1. Where did the incense altar stand? In front of the veil, near the ark
  2. What happened on its horns once a year? Aaron put blood on them to make atonement.
  3. How much did each counted person give? Half a shekel
  4. Where did the bronze basin stand? Between the tent and the altar
  5. Why could no one copy the holy oil? It was holy, set apart only for God.
1: God said, You shall make an altar to burn incense on2: God said, When you take a census of the children of Israel3: God said, You shall also make a basin of bronze4: God said, You shall make it into a holy anointing oil

Grade 4Prayer, Equality and Cleansing

  1. What does Psalm 141:2 compare prayer to? Incense
  2. What did the equal half shekel show? Rich and poor were equal before God.
  3. Why did the priests wash? God wants His servants to be clean.
  4. What makes us clean from sin? Jesus' blood

Word bank: 1. incense; 2. God; 3. pray

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Incense, Ransom and Washing

  1. What does incense picture in Scripture? The prayers of God's people
  2. Why did even the incense altar need atonement? Even worship needed cleansing from sin.
  3. Why was the ransom money the same for everyone? All stood equal before God and all needed redemption.
  4. According to 1 Peter 1:18-19, what redeems believers? The precious blood of Christ, not silver or gold
  5. What do Christians often see pictured in the anointing oil? The Holy Spirit

Word bank: 1. incense; 2. God; 3. wash; 4. oil; 5. holy

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.