The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 8

For teachers and parents. Prints separately from the student sheets.

Ecclesiastes 8 · For teachers and parents

Answer Key: Better with Those Who Fear God

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Shining Face

heartsunscrollpersontree

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenWise

WISE → picture 2SHINE → picture 4OBEY → picture 1JOY → picture 3

Grade 1Fear God

Wisdom makes a man's face shine. → picture 2Keep the king's command. → picture 4Whoever keeps the commandment shall not come to harm. → picture 5It will be better with those who fear God. → picture 1Eat, drink, and be joyful. → picture 3

Order:

1. A man’s wisdom makes his face shine2. Whoever keeps the commandment shall not come to harm3. But it shall not be well with the wicked, neither shall he lengthen days like a shadow, because he doesn’t fear God4. Then I commended mirth, because a man has no better thing under the sun than to eat, to drink, and to be joyful

Grade 2Better with Those Who Fear God

  1. What does wisdom make shine? A person's face (circle)
  2. Whom should we obey? The king (circle)
  3. Who shall not come to harm? Whoever keeps the commandment
  4. Who will it be better with? Those who fear God (circle)
GODTIMEILBWDKBHLEPAOIPPNTGISROSHFACEHKKYDHCIUIFPHHOALSNMEGTHMROEKTAWGMAMGDSIRONSH

Grade 3Wisdom Makes the Face Shine

  1. What is changed when wisdom makes the face shine? The hardness of his face
  2. Why should we keep the king's command? Because of the oath to God
  3. What happens when sentence is not executed speedily? People are set to do evil.
  4. What can no one find out? All the work of God
1: A man’s wisdom makes his face shine2: Whoever keeps the commandment shall not come to harm3: But it shall not be well with the wicked, neither shall he lengthen days like a shadow, because he doesn’t fear God4: Then I commended mirth, because a man has no better thing under the sun than to eat, to drink, and to be joyful
AVMSWFJNJGPMMIANVMNCRTSCHAMSEKPDEEVFGHWOOLHVFSNIOMSHFTOGINRJAEILOTOEKRAMWDDRLJMRE

Grade 4Trusting God's Justice

  1. What does a man's wisdom make shine? His face
  2. What will the wise heart know? The time and procedure
  3. What happens when wrong is not punished quickly? People do more wrong.
  4. Who are reverent before God? Those who fear God
  5. What shall not be well with the wicked? It

Word bank: 1. wisdom; 2. God; 3. harm

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Beyond Our Understanding

  1. What questions open the chapter? Who is like the wise man? And who knows the interpretation of a thing?
  2. Why are people set to do evil? Sentence against an evil work is not executed speedily.
  3. Why shall it not be well with the wicked? Because he doesn't fear God
  4. What can man not find out? The work that is done under the sun
  5. What depth does Paul praise? The riches both of the wisdom and the knowledge of God
4HARM1WOK2SINE5REVRENT3TIM

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.