The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Every grade prints starting on a new page. No answers are included.

Ecclesiastes 8 · Preschool

A Shining Face

Name Date

Color the happy, shining face!

Can you find these in the picture? Circle each one!

Bible Verse

“Who is like the wise man? And who knows the interpretation of a thing? A man’s wisdom makes his face shine, and the hardness of his face is changed.”

Ecclesiastes 8:1 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When we follow God's wisdom, it shows on our faces! Let's smile and thank God for His wisdom.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Kindergarten

Wise

Name Date

Trace the Words

Trace each word with your pencil.

WISE
SHINE
OBEY
JOY
Whoever keeps the commandment shall not come to harm, and his wise heart will know the time and procedure.

Ecclesiastes 8:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

WISE
SHINE
OBEY
JOY

Mini Maze

Help find the way through the maze.

Draw It

Draw someone keeping God's commandments.

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What makes your face shine?
  • How can you show joy?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Grade 1

Fear God

Name Date

Trace the Words

Trace the words and the verse.

SHINE
OBEY
FEAR
JOY
Whoever keeps the commandment shall not come to harm, and his wise heart will know the time and procedure.

Ecclesiastes 8:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Wisdom makes a man's face shine.
Keep the king's command.
Whoever keeps the commandment shall not come to harm.
It will be better with those who fear God.
Eat, drink, and be joyful.

Better with Those Who Fear God

Write the number 1 to 4 in each circle to show the right order.

But it shall not be well with the wicked, neither shall he lengthen days like a shadow, because he doesn’t fear God

Whoever keeps the commandment shall not come to harm

Then I commended mirth, because a man has no better thing under the sun than to eat, to drink, and to be joyful

A man’s wisdom makes his face shine

Draw someone keeping God's commandments.

Memory Verse

“Whoever keeps the commandment shall not come to harm, and his wise heart will know the time and procedure.”

Ecclesiastes 8:5 (WEB)

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does wisdom do to a face?
  • Whom should we obey?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Grade 2

Better with Those Who Fear God

Name Date

Read the Story

The Preacher said that wisdom makes a person's face shine. Wise people are glad and kind.

He said to obey the king. Whoever keeps the commandment shall not come to harm.

Sometimes it looks like bad people get away with wrong. But the Preacher knew it will be better with those who fear God.

Memory Verse

“Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him.”

Ecclesiastes 8:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does wisdom make shine?

    A person's faceThose who fear GodThe king

  2. Whom should we obey?

    The kingA person's faceThose who fear God

  3. Who shall not come to harm?

  4. Who will it be better with?

    The kingThose who fear GodA person's face

Word Search

Find and circle each word. Words go across and down.

GODTIMEILBWDKBHLEPAOIPPNTGISROSHFACEHKKYDHCIUIFPHHOALSNMEGTHMROEKTAWGMAMGDSIRONSH
  • WISDOM
  • SHINE
  • FACE
  • HARM
  • TIME
  • FEAR
  • WORK
  • GOD

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you obey your parents and the grown-ups who care for you?
  • How can you show that you honor God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Grade 3

Wisdom Makes the Face Shine

Name Date

Read the Story

Who is like the wise man? A man's wisdom makes his face shine, and the hardness of his face is changed. The Preacher said, Keep the king's command! because of the oath to God.

Whoever keeps the commandment shall not come to harm. Because sentence against an evil work is not executed speedily, therefore the heart of the sons of men is fully set in them to do evil.

Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God. Then I commended mirth. No one can find out all the work of God.

Memory Verse

“Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him.”

Ecclesiastes 8:12 (WEB)

Answer the Questions

  1. What is changed when wisdom makes the face shine?

  2. Why should we keep the king's command?

  3. What happens when sentence is not executed speedily?

  4. What can no one find out?

Better with Those Who Fear God

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

AVMSWFJNJGPMMIANVMNCRTSCHAMSEKPDEEVFGHWOOLHVFSNIOMSHFTOGINRJAEILOTOEKRAMWDDRLJMRE
  • WISDOM
  • SHINE
  • FACE
  • HARM
  • TIME
  • FEAR
  • WORK
  • GOD

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God when you do not understand?
  • What did the Preacher commend?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Grade 4

Trusting God's Justice

Name Date

Read and Think

Chapter 8 begins with praise for wisdom. Who is like the wise man? And who knows the interpretation of a thing? A man's wisdom makes his face shine, and the hardness of his face is changed. The Preacher urges obedience to rulers: I say, Keep the king's command! because of the oath to God.

He says, Whoever keeps the commandment shall not come to harm, and his wise heart will know the time and procedure. He also sees a problem: Because sentence against an evil work is not executed speedily, therefore the heart of the sons of men is fully set in them to do evil. When wrong is not punished quickly, people do more wrong.

Still, the Preacher trusts God's justice. Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him. But it shall not be well with the wicked. He commends joy, and he admits that man can't find out the work that is done under the sun.

Show What You Know

  1. What does a man's wisdom make shine?

  2. What will the wise heart know?

  3. What happens when wrong is not punished quickly?

  4. Who are reverent before God?

  5. What shall not be well with the wicked?

Word Bank Fill-In

Use the word bank to fill in each blank.

harmwisdomGod
  1. Chapter 8 begins with praise for .
  2. because of the oath to .
  3. He says, Whoever keeps the commandment shall not come to , and his wise heart will know the time and procedure.

Think About It

  1. Whoever keeps the commandment shall not come to harm. How does obeying God's commands protect you?

  2. It will be better with those who fear God. How does this help when it seems like wrong goes unpunished?

Memory Verse

“Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him.”

Ecclesiastes 8:12 (WEB)

Copy It

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is it hard to wait for justice?
  • How can you trust God when you do not understand what He is doing?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 8 · Grade 5

Beyond Our Understanding

Name Date

Read and Think

Chapter 8 opens with a question: Who is like the wise man? And who knows the interpretation of a thing? A man's wisdom makes his face shine, and the hardness of his face is changed. The Preacher then counsels respect for authority: I say, Keep the king's command! because of the oath to God. Whoever keeps the commandment shall not come to harm, and his wise heart will know the time and procedure.

The Preacher observes delayed justice. Because sentence against an evil work is not executed speedily, therefore the heart of the sons of men is fully set in them to do evil. Yet he holds to faith: Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him. But it shall not be well with the wicked, neither shall he lengthen days like a shadow, because he doesn't fear God.

He commends joy as God's gift: a man has no better thing under the sun than to eat, to drink, and to be joyful. Finally he admits his limits: then I saw all the work of God, that man can't find out the work that is done under the sun. God's ways are higher than ours. In the New Testament, Paul praises the depth of the riches both of the wisdom and the knowledge of God (Romans 11:33).

Show What You Know

  1. What questions open the chapter?

  2. Why are people set to do evil?

  3. Why shall it not be well with the wicked?

  4. What can man not find out?

  5. What depth does Paul praise?

Crossword

41253

Across

  1. Whoever keeps the commandment shall not come to ____
  2. who are ____ before him

Down

  1. then I saw all the ____ of God
  2. A man’s wisdom makes his face ____
  3. and his wise heart will know the ____ and procedure

Think About It

  1. Man can't find out the work that is done under the sun. How can you trust God when you don't understand what He is doing?

  2. A man's wisdom makes his face shine. How can others see God's wisdom in your life?

Memory Verse

“Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him.”

Ecclesiastes 8:12 (WEB)

Copy It

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can God's wisdom be deeper than ours?
  • How can others see God's wisdom in you?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.