The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Prints on letter paper in black and white. No answers are printed on the student sheet.

Ecclesiastes 8 · Grade 3

Wisdom Makes the Face Shine

Name Date

Read the Story

Who is like the wise man? A man's wisdom makes his face shine, and the hardness of his face is changed. The Preacher said, Keep the king's command! because of the oath to God.

Whoever keeps the commandment shall not come to harm. Because sentence against an evil work is not executed speedily, therefore the heart of the sons of men is fully set in them to do evil.

Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God. Then I commended mirth. No one can find out all the work of God.

Memory Verse

“Though a sinner commits crimes a hundred times, and lives long, yet surely I know that it will be better with those who fear God, who are reverent before him.”

Ecclesiastes 8:12 (WEB)

Answer the Questions

  1. What is changed when wisdom makes the face shine?

  2. Why should we keep the king's command?

  3. What happens when sentence is not executed speedily?

  4. What can no one find out?

Better with Those Who Fear God

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

AVMSWFJNJGPMMIANVMNCRTSCHAMSEKPDEEVFGHWOOLHVFSNIOMSHFTOGINRJAEILOTOEKRAMWDDRLJMRE
  • WISDOM
  • SHINE
  • FACE
  • HARM
  • TIME
  • FEAR
  • WORK
  • GOD

Prayer

Dear God, thank You for being with those who fear You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God when you do not understand?
  • What did the Preacher commend?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.