The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 7

For teachers and parents. Prints separately from the student sheets.

Ecclesiastes 7 · For teachers and parents

Answer Key: Better Things

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolBe Patient

persontreesunflowerpeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenBetter

NAME → picture 4WAIT → picture 3CALM → picture 1WISE → picture 2

Grade 1Better Things

A good name is better than fine perfume. → picture 5The patient in spirit is better than the proud. → picture 1Don't be hasty to be angry. → picture 4Wisdom preserves the life of him who has it. → picture 2In the day of prosperity be joyful. → picture 3

Order:

1. A good name is better than fine perfume2. Better is the end of a thing than its beginning3. For wisdom is a defense4. In the day of prosperity be joyful

Grade 2What Is Better

  1. What is a good name better than? Fine perfume (circle)
  2. Whom should we listen to? A wise person who corrects us
  3. What should we not be quick to do? Get angry (circle)
  4. Who sins? Everyone (circle)
BHBJOYFULKEPWRTETENPGEILNKSHAAIRSDKRFDMTNFDBSUINEINUOYFWVHBEIMMSPIRITNNEOSRFDWOTG

Grade 3The Patient in Spirit

  1. What is better than the song of fools? The rebuke of the wise
  2. Who is better than the proud in spirit? The patient in spirit
  3. Where does anger rest? In the bosom of fools
  4. How did God make mankind? Upright
1: A good name is better than fine perfume2: Better is the end of a thing than its beginning3: For wisdom is a defense4: In the day of prosperity be joyful
WBPOSHFRBIPSPIRITESPEYNLWVGDAJRTADOIOTFOFWMWNMILEYUVENREERNFMOIGNATWDUENBTLOFEPLG

Grade 4Wisdom's Better Way

  1. What is the laughter of the fool like? The crackling of thorns under a pot
  2. What is better than its beginning? The end of a thing
  3. What should you not say about the former days? Why were the former days better than these?
  4. What is wisdom a strength more than? Ten rulers who are in a city
  5. What should you do in the day of adversity? Consider

Word bank: 1. name; 2. end; 3. patient; 4. Wisdom; 5. joyful

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5No One Is Righteous

  1. Why should the living take mourning to heart? That is the end of all men.
  2. Where does anger rest? In the bosom of fools
  3. What does wisdom preserve? The life of him who has it
  4. Who has made prosperity and adversity side by side? God
  5. What does Paul say all have done? Sinned, and fall short of the glory of God
4WISELY2JOFUL1PATENT3PRFUME5DEFNSE

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.