The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Every grade prints starting on a new page. No answers are included.

Ecclesiastes 7 · Preschool

Be Patient

Name Date

Color the child waiting patiently!

Can you find these in the picture? Circle each one!

Bible Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Being patient means waiting kindly. God helps us be patient instead of proud or grumpy. Let's practice waiting with a smile!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Kindergarten

Better

Name Date

Trace the Words

Trace each word with your pencil.

NAME
WAIT
CALM
WISE
Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.

Ecclesiastes 7:8 (WEB)

Match the Pictures

Draw a line from each word to its picture.

NAME
WAIT
CALM
WISE

Mini Maze

Help find the way through the maze.

Draw It

Draw something that takes patience.

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be patient?
  • How can you wait kindly?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Grade 1

Better Things

Name Date

Trace the Words

Trace the words and the verse.

NAME
PATIENT
ANGER
WISDOM
Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.

Ecclesiastes 7:8 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

A good name is better than fine perfume.
The patient in spirit is better than the proud.
Don't be hasty to be angry.
Wisdom preserves the life of him who has it.
In the day of prosperity be joyful.

Better Things

Write the number 1 to 4 in each circle to show the right order.

Better is the end of a thing than its beginning

In the day of prosperity be joyful

A good name is better than fine perfume

For wisdom is a defense

Draw something that takes patience.

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is a good name better than?
  • Whom should we listen to?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Grade 2

What Is Better

Name Date

Read the Story

The Preacher listed things that are better. A good name is better than fine perfume. It is better to listen to a wise person who corrects you than to listen to fools.

He said, The patient in spirit is better than the proud in spirit. Don't be quick to get angry.

He said everyone sins. There is no one on earth who always does good. That is why we all need God.

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is a good name better than?

    EveryoneGet angryFine perfume

  2. Whom should we listen to?

  3. What should we not be quick to do?

    Fine perfumeEveryoneGet angry

  4. Who sins?

    Fine perfumeEveryoneGet angry

Word Search

Find and circle each word. Words go across and down.

BHBJOYFULKEPWRTETENPGEILNKSHAAIRSDKRFDMTNFDBSUINEINUOYFWVHBEIMMSPIRITNNEOSRFDWOTG
  • BEGINNING
  • PERFUME
  • PATIENT
  • SPIRIT
  • WISDOM
  • JOYFUL
  • NAME
  • END

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you slow down before getting angry?
  • Why does everyone need God's forgiveness?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Grade 3

The Patient in Spirit

Name Date

Read the Story

A good name is better than fine perfume. It is better to hear the rebuke of the wise than for a man to hear the song of fools.

Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit. Don't be hasty in your spirit to be angry, for anger rests in the bosom of fools.

In the day of prosperity be joyful, and in the day of adversity consider. Surely there is not a righteous man on earth who does good and doesn't sin. God made mankind upright; but they search for many inventions.

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Answer the Questions

  1. What is better than the song of fools?

  2. Who is better than the proud in spirit?

  3. Where does anger rest?

  4. How did God make mankind?

Better Things

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WBPOSHFRBIPSPIRITESPEYNLWVGDAJRTADOIOTFOFWMWNMILEYUVENREERNFMOIGNATWDUENBTLOFEPLG
  • BEGINNING
  • PERFUME
  • PATIENT
  • SPIRIT
  • WISDOM
  • JOYFUL
  • NAME
  • END

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • When can you choose to calm down instead of getting upset?
  • How have people turned from the way God made them?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Grade 4

Wisdom's Better Way

Name Date

Read and Think

Chapter 7 uses many better than sayings. A good name is better than fine perfume. The Preacher says that the house of mourning teaches the living to take life to heart. It is better to hear the rebuke of the wise than for a man to hear the song of fools. For as the crackling of thorns under a pot, so is the laughter of the fool.

Patience and calm are wise. Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit. Don't be hasty in your spirit to be angry, for anger rests in the bosom of fools. Don't say, Why were the former days better than these? For you do not ask wisely about this.

Wisdom protects. Wisdom is a strength to the wise man more than ten rulers who are in a city. In the day of prosperity be joyful, and in the day of adversity consider; yes, God has made the one side by side with the other. Surely there is not a righteous man on earth who does good and doesn't sin. Behold, I have only found this: that God made mankind upright; but they search for many inventions.

Show What You Know

  1. What is the laughter of the fool like?

  2. What is better than its beginning?

  3. What should you not say about the former days?

  4. What is wisdom a strength more than?

  5. What should you do in the day of adversity?

Word Bank Fill-In

Use the word bank to fill in each blank.

endpatientnameWisdomjoyful
  1. A good is better than fine perfume.
  2. Better is the of a thing than its beginning.
  3. The in spirit is better than the proud in spirit.
  4. protects.
  5. In the day of prosperity be , and in the day of adversity consider; yes, God has made the one side by side with the other.

Think About It

  1. Don't be hasty in your spirit to be angry. What helps you slow down when you start to feel angry?

  2. God has made the one side by side with the other. How can you trust God in both good days and hard days?

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Copy It

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you build a good name?
  • How can you be thankful for today instead of wishing for the past?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ecclesiastes 7 · Grade 5

No One Is Righteous

Name Date

Read and Think

Chapter 7 shifts into proverbs that compare one thing as better than another. A good name is better than fine perfume. The Preacher says it is better to go to the house of mourning than to go to the house of feasting, for that is the end of all men, and the living should take this to heart. Sorrow can teach us what laughter cannot. It is better to hear the rebuke of the wise than for a man to hear the song of fools.

The wise are patient and humble. Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit. Don't be hasty in your spirit to be angry, for anger rests in the bosom of fools. Don't say, Why were the former days better than these? For you do not ask wisely about this. Wisdom is as good as an inheritance. Verse 12 adds that wisdom preserves the life of him who has it.

God rules all our days. In the day of prosperity be joyful, and in the day of adversity consider; yes, God has made the one side by side with the other. The Preacher makes a sobering point: Surely there is not a righteous man on earth who does good and doesn't sin. God made mankind upright; but they search for many inventions. In the New Testament, Paul writes, for all have sinned, and fall short of the glory of God (Romans 3:23).

Show What You Know

  1. Why should the living take mourning to heart?

  2. Where does anger rest?

  3. What does wisdom preserve?

  4. Who has made prosperity and adversity side by side?

  5. What does Paul say all have done?

Crossword

42135

Across

  1. For you do not ask ____ about this
  2. For wisdom is a ____

Down

  1. The ____ in spirit is better than the proud in spirit
  2. In the day of prosperity be ____
  3. A good name is better than fine ____

Think About It

  1. Don't say, Why were the former days better than these? How can you be thankful for today instead of wishing for the past?

  2. There is not a righteous man on earth who does good and doesn't sin. How does this point us to our need for Jesus?

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Copy It

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why do all people need God's grace?
  • How can you be thankful for today?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.