The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Prints on letter paper in black and white. No answers are printed on the student sheet.

Ecclesiastes 7 · Grade 2

What Is Better

Name Date

Read the Story

The Preacher listed things that are better. A good name is better than fine perfume. It is better to listen to a wise person who corrects you than to listen to fools.

He said, The patient in spirit is better than the proud in spirit. Don't be quick to get angry.

He said everyone sins. There is no one on earth who always does good. That is why we all need God.

Memory Verse

“Better is the end of a thing than its beginning. The patient in spirit is better than the proud in spirit.”

Ecclesiastes 7:8 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is a good name better than?

    EveryoneGet angryFine perfume

  2. Whom should we listen to?

  3. What should we not be quick to do?

    Fine perfumeEveryoneGet angry

  4. Who sins?

    Fine perfumeEveryoneGet angry

Word Search

Find and circle each word. Words go across and down.

BHBJOYFULKEPWRTETENPGEILNKSHAAIRSDKRFDMTNFDBSUINEINUOYFWVHBEIMMSPIRITNNEOSRFDWOTG
  • BEGINNING
  • PERFUME
  • PATIENT
  • SPIRIT
  • WISDOM
  • JOYFUL
  • NAME
  • END

Prayer

Dear God, thank You for patience. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you slow down before getting angry?
  • Why does everyone need God's forgiveness?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.