The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 8

For teachers and parents. Prints separately from the student sheets.

Deuteronomy 8 · For teachers and parents

Answer Key: Not by Bread Alone

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Feeds Me

mannawheatrockmountain

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Gives Bread

MANNA → picture 2BREAD → picture 4WHEAT → picture 1GRAPES → picture 3

Grade 1Every Word of God

God fed them with manna. → picture 2Their clothes did not wear out. → picture 4The land had wheat. → picture 5The land had springs. → picture 1Bless God when you are full. → picture 3

Order:

1. God fed them with manna2. Clothes did not wear out3. A land of wheat and barley4. Eat and bless God

Grade 2God Took Care of Them

  1. How long did they walk in the desert? Forty years (circle)
  2. What did God give them to eat? Manna (circle)
  3. What do we need more than bread? God's word (circle)
  4. What did the good land have? Water, wheat, grapes, and figs
  5. Who gives power to get rich? God (circle)
CMWPMANNABARLEYPYWSJFHUMBLEWHEATTHVIJEODDIRSKOHWVDYFHFHFORGETRIOGHONEYSGYBREADPPS

Grade 3Remember the Way

  1. Why did God feed them with manna? To teach them people live by every word from God's mouth
  2. What did not grow old? Their clothes
  3. How did God discipline them? Like a father disciplines his son
  4. Name three good things in the land. Wheat, figs, and olives
  5. What must they never say? That their own power made them rich
1: God fed them with manna2: Clothes did not wear out3: A land of wheat and barley4: Eat and bless God
KOLLKTMHCPFBIAKAUKWNOAFANMNHHURRKNBTFOEAGLALBBINASEEERMHGETVTYEWIVSYTGYAMLAITPFBD

Grade 4Every Word from God's Mouth

  1. Why did God humble and test Israel? To know what was in their hearts
  2. When did Jesus quote 8:3? When Satan tempted Him to turn stones into bread
  3. What was the danger in the good land? Plenty could make them proud.
  4. Who gives the power to get wealth? God

Word bank: 1. humble; 2. bread; 3. good; 4. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Remember, Do Not Forget

  1. What are the key words of Deuteronomy 8? Remember and do not forget
  2. Why did God allow hunger and give manna? To teach that people live by every word from the Lord
  3. How did Jesus use this verse? He answered Satan in the wilderness, trusting His Father.
  4. Why is God's discipline good? It is like a father training his son, not to harm him.
  5. How is prosperity a test? The heart can be lifted up and forget God.
3BREAD1MNNA4BRLEYLESS2FORGT

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.