The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Every grade prints starting on a new page. No answers are included.

Deuteronomy 8 · Preschool

God Feeds Me

Name Date

Color the manna and the bread! God gave His people food every day.

Can you find these in the picture? Circle each one!

Bible Verse

“He humbled you, allowed you to be hungry, and fed you with manna, which you didn’t know, neither did your fathers know, that he might teach you that man does not live by bread only, but man lives by every word that proceeds out of Yahweh’s mouth.”

Deuteronomy 8:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God gives us food. He gives us His word too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Kindergarten

God Gives Bread

Name Date

Trace the Words

Trace each word with your pencil.

BREAD
WORD
GOD
FOOD
You shall eat and be full, and you shall bless Yahweh your God for the good land which he has given you.

Deuteronomy 8:10 (WEB)

Match the Pictures

Draw a line from each word to its picture.

MANNA
BREAD
WHEAT
GRAPES

Mini Maze

Help find the way through the maze.

Draw It

Draw a meal and write a thank-you to God.

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • What food did God give in the desert?
  • What can you thank God for at dinner?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Grade 1

Every Word of God

Name Date

Trace the Words

Trace the words and the verse.

BREAD
WORD
MANNA
BLESS
You shall eat and be full, and you shall bless Yahweh your God for the good land which he has given you.

Deuteronomy 8:10 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God fed them with manna.
Their clothes did not wear out.
The land had wheat.
The land had springs.
Bless God when you are full.

Remember the Lord

Write the number 1 to 4 in each circle to show the right order.

A land of wheat and barley

God fed them with manna

Eat and bless God

Clothes did not wear out

Draw a meal and write a thank-you to God.

Memory Verse

“You shall eat and be full, and you shall bless Yahweh your God for the good land which he has given you.”

Deuteronomy 8:10 (WEB)

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God take care of you?
  • What did God want them to learn?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Grade 2

God Took Care of Them

Name Date

Read the Story

Moses said, Remember the long walk in the desert. It took forty years. God led you every day.

God gave you manna to eat. He taught you that people need more than bread. We need God's word too. Your clothes did not wear out. Your feet did not swell.

Now God is giving you a good land. It has water, wheat, grapes, and figs. When you eat and are full, bless God. Do not forget Him. Do not say, I got rich by myself. God gives you power to do it.

Memory Verse

“He humbled you, allowed you to be hungry, and fed you with manna, which you didn’t know, neither did your fathers know, that he might teach you that man does not live by bread only, but man lives by every word that proceeds out of Yahweh’s mouth.”

Deuteronomy 8:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How long did they walk in the desert?

    GodForty yearsManna

  2. What did God give them to eat?

    MannaGod's wordForty years

  3. What do we need more than bread?

    God's wordForty yearsGod

  4. What did the good land have?

  5. Who gives power to get rich?

    Forty yearsGodGod's word

Word Search

Find and circle each word. Words go across and down.

CMWPMANNABARLEYPYWSJFHUMBLEWHEATTHVIJEODDIRSKOHWVDYFHFHFORGETRIOGHONEYSGYBREADPPS
  • BARLEY
  • FORGET
  • HUMBLE
  • MANNA
  • BREAD
  • WHEAT
  • HONEY
  • FIGS

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you thank God for when your tummy is full?
  • How has God taken care of your family?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Grade 3

Remember the Way

Name Date

Read the Story

Moses told Israel to remember all the way God led them for forty years. God let them be hungry and then fed them with manna. He was teaching them that people do not live by bread only, but by every word from God's mouth.

In all those years, their clothes did not grow old and their feet did not swell. God disciplined them like a father disciplines his son, for their good.

The land ahead was good, with brooks, springs, wheat, barley, vines, figs, olives, and honey. Its stones were iron and its hills held copper. When they were full, they must bless God. They must never say their own power made them rich.

Memory Verse

“He humbled you, allowed you to be hungry, and fed you with manna, which you didn’t know, neither did your fathers know, that he might teach you that man does not live by bread only, but man lives by every word that proceeds out of Yahweh’s mouth.”

Deuteronomy 8:3 (WEB)

Answer the Questions

  1. Why did God feed them with manna?

  2. What did not grow old?

  3. How did God discipline them?

  4. Name three good things in the land.

  5. What must they never say?

Remember the Lord

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

KOLLKTMHCPFBIAKAUKWNOAFANMNHHURRKNBTFOEAGLALBBINASEEERMHGETVTYEWIVSYTGYAMLAITPFBD
  • BARLEY
  • FORGET
  • HUMBLE
  • MANNA
  • BREAD
  • WHEAT
  • HONEY
  • FIGS

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did God let Israel be hungry?
  • Why should we thank God when we have plenty?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Grade 4

Every Word from God's Mouth

Name Date

Read and Think

Moses called Israel to remember the wilderness. God led them forty years to humble them and to test what was in their hearts. He let them hunger, then fed them with manna, which they had never known, so they would learn that people live by every word that comes from God's mouth.

Satan tempted Jesus to turn stones into bread. Jesus said, Man shall not live by bread alone, but by every word that proceeds out of God's mouth (Matthew 4:4). The wilderness years showed God's care: clothes did not wear out and feet did not swell. Like a father, God disciplined His people for their good.

The danger ahead was not hunger but plenty. In a land of wheat, barley, vines, figs, pomegranates, olives, honey, iron, and copper, Israel might grow proud and say, My power and my hand got me this wealth. Moses said, Remember God, for it is He who gives you power to get wealth.

Show What You Know

  1. Why did God humble and test Israel?

  2. When did Jesus quote 8:3?

  3. What was the danger in the good land?

  4. Who gives the power to get wealth?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godgoodbreadhumble
  1. God led them forty years to them and to test what was in their hearts.
  2. Satan tempted Jesus to turn stones into .
  3. Like a father, God disciplined His people for their .
  4. Moses said, Remember , for it is He who gives you power to get wealth.

Think About It

  1. What does it mean to live by every word from God's mouth?

  2. When things go well, how can you guard against pride?

Memory Verse

“He humbled you, allowed you to be hungry, and fed you with manna, which you didn’t know, neither did your fathers know, that he might teach you that man does not live by bread only, but man lives by every word that proceeds out of Yahweh’s mouth.”

Deuteronomy 8:3 (WEB)

Copy It

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is it easy to forget God when life is good?
  • How did Jesus use this chapter when He was tempted?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 8 · Grade 5

Remember, Do Not Forget

Name Date

Read and Think

The key words of Deuteronomy 8 are remember and do not forget. God led Israel forty years in the wilderness to humble them, test them, and reveal what was in their hearts. He allowed hunger and then fed them manna so they would learn that people do not live by bread only, but by every word from the mouth of the Lord.

Jesus used this verse to answer Satan in the wilderness: Man shall not live by bread alone, but by every word that proceeds out of God's mouth (Matthew 4:4). He trusted His Father rather than His own power. The same chapter shows God as a father who disciplines his son, not to harm him, but to train him. Even their clothing did not grow old in forty years.

Moses warns that prosperity is a test too. When houses are built, flocks multiply, and silver and gold increase, the heart can be lifted up and forget God. Israel must not say, My power and the might of my hand has gotten me this wealth. Remembering that God gives the power to get wealth keeps the heart humble and grateful.

Show What You Know

  1. What are the key words of Deuteronomy 8?

  2. Why did God allow hunger and give manna?

  3. How did Jesus use this verse?

  4. Why is God's discipline good?

  5. How is prosperity a test?

Crossword

3142

Across

  1. Man does not live by ____ only.
  2. A land of wheat and ____.

Down

  1. God fed you with ____.
  2. Beware that you do not ____ God.
  3. When you eat, ____ God.

Think About It

  1. Hard times and good times both test the heart. Which do you find harder, and why?

  2. Make a list of good gifts God has given you. How can you remember Him in them?

Memory Verse

“He humbled you, allowed you to be hungry, and fed you with manna, which you didn’t know, neither did your fathers know, that he might teach you that man does not live by bread only, but man lives by every word that proceeds out of Yahweh’s mouth.”

Deuteronomy 8:3 (WEB)

Copy It

Prayer

Dear God, thank You for my daily bread. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep God first when everything is going well?
  • Why must we remember that God gives the power to get wealth?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.