The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 33

For teachers and parents. Prints separately from the student sheets.

Deuteronomy 33 · For teachers and parents

Answer Key: Moses Blesses the Tribes

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Holds Me

peoplemountainhearthand

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod's Arms

ARMS → picture 3HOME → picture 1TRIBES → picture 4MOUNTAIN → picture 2

Grade 1Safe With God

His arms are under you. → picture 4God is your home. → picture 3Moses blessed the tribes. → picture 1Benjamin is loved by God. → picture 5God came from Sinai. → picture 2

Order:

1. Moses blesses Israel2. God came from Sinai3. Benjamin dwells in safety4. The everlasting arms

Grade 2Underneath Are His Arms

  1. When did Moses bless the people? Before he died (circle)
  2. Who did Moses bless? Each family of Israel (circle)
  3. Who is loved by God? Benjamin (circle)
  4. What is under you? God's arms that last forever
  5. Why is Israel happy? God has saved them. (circle)
BVTRIBESHBNHJUDAHIRLAAVADIVASESINAIHRPASLADGAMDDFSEHVPSFRTEIVGPNVPPKTNIYVBIOOTYGH

Grade 3The Everlasting Arms

  1. Where did God come from to give the law? Sinai
  2. What would Levi teach? God's ordinances
  3. Who would dwell in safety? Benjamin, the beloved of Yahweh
  4. What is underneath God's people? The everlasting arms
  5. Who is like Israel? No one, a people saved by Yahweh
1: Moses blesses Israel2: God came from Sinai3: Benjamin dwells in safety4: The everlasting arms
JAATWIFOKLBLARMSTUUJLEHIRPFSIUEVABVBTASDSIPEREYFIASVPSYIAENHIFYLYWPTANNPSCUFNYIOG

Grade 4Blessings for Each Tribe

  1. What earlier blessing is this like? Jacob's blessing in Genesis 49
  2. What would Levi do? Teach God's law and serve at the altar
  3. Which tribe is not named? Simeon
  4. Why is Israel happy? Because they are a people saved by Yahweh

Word bank: 1. Sinai; 2. Judah; 3. arms; 4. happy

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Eternal God Is Your Dwelling Place

  1. How is the law described? As an inheritance, a gift of love rather than a burden
  2. Where did Levi prove faithful? At Massah and Meribah
  3. Whose favor did Joseph receive? The favor of him who lived in the bush
  4. What is Israel's dwelling place? The eternal God
  5. How do believers share this security? In Christ, from whose hand no one can snatch them
4DWELLING2SAFTY3SIAI5HAPP1ARM

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.