The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 33

Every grade prints starting on a new page. No answers are included.

Deuteronomy 33 · Preschool

God Holds Me

Name Date

Color the strong arms holding the people! God's arms hold us up forever.

Can you find these in the picture? Circle each one!

Bible Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God holds us in His arms that never get tired.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Kindergarten

God's Arms

Name Date

Trace the Words

Trace each word with your pencil.

ARMS
SAFE
BLESS
HOME
This is the blessing with which Moses the man of God blessed the children of Israel before his death.

Deuteronomy 33:1 (WEB)

Match the Pictures

Draw a line from each word to its picture.

ARMS
HOME
TRIBES
MOUNTAIN

Mini Maze

Help find the way through the maze.

Draw It

Draw God's strong arms holding you up.

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who holds you up?
  • Who can you ask God to bless?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Grade 1

Safe With God

Name Date

Trace the Words

Trace the words and the verse.

ARMS
SAFE
BLESS
TRIBES
This is the blessing with which Moses the man of God blessed the children of Israel before his death.

Deuteronomy 33:1 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

His arms are under you.
God is your home.
Moses blessed the tribes.
Benjamin is loved by God.
God came from Sinai.

Moses' Blessing

Write the number 1 to 4 in each circle to show the right order.

Benjamin dwells in safety

God came from Sinai

Moses blesses Israel

The everlasting arms

Draw God's strong arms holding you up.

Memory Verse

“This is the blessing with which Moses the man of God blessed the children of Israel before his death.”

Deuteronomy 33:1 (WEB)

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who did Moses bless?
  • Who holds you when you are sad?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Grade 2

Underneath Are His Arms

Name Date

Read the Story

Before Moses died, he blessed the people. He gave a blessing to each family of Israel.

He said, Benjamin is loved by God. He will live safe with God. God covers him all day long. Moses blessed the other families too.

At the end Moses said, There is no one like our God. God is your home. Under you are His arms that last forever. You are happy, Israel. God has saved you.

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. When did Moses bless the people?

    God has saved themEach family of IsraelBefore he died

  2. Who did Moses bless?

    Each family of IsraelGod has saved themBefore he died

  3. Who is loved by God?

    BenjaminBefore he diedEach family of Israel

  4. What is under you?

  5. Why is Israel happy?

    BenjaminGod has saved themBefore he died

Word Search

Find and circle each word. Words go across and down.

BVTRIBESHBNHJUDAHIRLAAVADIVASESINAIHRPASLADGAMDDFSEHVPSFRTEIVGPNVPPKTNIYVBIOOTYGH
  • BLESSING
  • SAFETY
  • TRIBES
  • SINAI
  • JUDAH
  • HAPPY
  • ARMS
  • LEVI

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who could you speak a kind blessing to today?
  • What does it mean that God is our home?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Grade 3

The Everlasting Arms

Name Date

Read the Story

Moses, the man of God, blessed Israel before his death. He said God came from Sinai and gave them the law. Moses commanded the law as an inheritance for Israel.

He blessed each tribe. Levi would teach God's ordinances and offer incense. Benjamin, the beloved of Yahweh, would dwell in safety. Joseph's land would be blessed with dew, the sun, and the best of the ancient mountains.

Moses ended with praise. There is no one like God, who rides on the heavens to help. The eternal God is your dwelling place. Underneath are the everlasting arms. You are happy, Israel! Who is like you, a people saved by Yahweh?

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Answer the Questions

  1. Where did God come from to give the law?

  2. What would Levi teach?

  3. Who would dwell in safety?

  4. What is underneath God's people?

  5. Who is like Israel?

Moses' Blessing

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

JAATWIFOKLBLARMSTUUJLEHIRPFSIUEVABVBTASDSIPEREYFIASVPSYIAENHIFYLYWPTANNPSCUFNYIOG
  • BLESSING
  • SAFETY
  • TRIBES
  • SINAI
  • JUDAH
  • HAPPY
  • ARMS
  • LEVI

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • When do you need to feel God holding you?
  • Why is God called a dwelling place?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Grade 4

Blessings for Each Tribe

Name Date

Read and Think

Deuteronomy 33 records Moses' final blessing on the tribes, like Jacob's blessing in Genesis 49. It begins with God coming from Sinai with His holy ones. He gave the law out of love for His people.

Each tribe receives a word. Reuben would live. Judah would have help against enemies. Levi would teach God's law and serve at the altar. Benjamin is the beloved of Yahweh, covered by Him all day long. Joseph receives rich blessings of land and strength. Simeon is not named.

The song ends by praising Israel's God, not Israel. There is no one like Him. He is their eternal dwelling place, holding them with everlasting arms. Israel is happy only because they are a people saved by Yahweh, their shield and help.

Show What You Know

  1. What earlier blessing is this like?

  2. What would Levi do?

  3. Which tribe is not named?

  4. Why is Israel happy?

Word Bank Fill-In

Use the word bank to fill in each blank.

armsJudahhappySinai
  1. It begins with God coming from with His holy ones.
  2. would have help against enemies.
  3. He is their eternal dwelling place, holding them with everlasting .
  4. Israel is only because they are a people saved by Yahweh, their shield and help.

Think About It

  1. Where do you need to rest on God's everlasting arms?

  2. Moses praises God at the end, not Israel. Why does that matter?

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Copy It

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Which blessing in this chapter would you most like to receive, and why?
  • How is God's law a gift of love?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 33 · Grade 5

The Eternal God Is Your Dwelling Place

Name Date

Read and Think

Deuteronomy 33 is Moses' last blessing on the tribes, parallel to Jacob's blessing in Genesis 49. It opens with a vision of God's majesty. Yahweh came from Sinai, rose from Seir, and shone from Mount Paran, with myriads of holy ones. Yes, he loves the people. The law Moses gave was an inheritance for the assembly of Jacob, a gift of love rather than a burden.

Moses then speaks a word over each tribe. Reuben would live and not die. Judah would be helped against his adversaries. Levi, faithful at Massah and Meribah, would teach Jacob God's ordinances and offer incense and whole burnt offerings. Benjamin, the beloved of Yahweh, would dwell in safety between His shoulders. Joseph receives abundant blessings of heaven, deep springs, and ancient mountains, with the favor of him who lived in the bush. Zebulun, Issachar, Gad, Dan, Naphtali, and Asher follow.

The blessing climaxes in praise: There is no one like God, Jeshurun, who rides on the heavens for your help. The eternal God is your dwelling place. Underneath are the everlasting arms. Israel's happiness and security rest entirely on God: Who is like you, a people saved by Yahweh, the shield of your help? Believers today share this security in Christ, from whose hand no one can snatch them (John 10:28).

Show What You Know

  1. How is the law described?

  2. Where did Levi prove faithful?

  3. Whose favor did Joseph receive?

  4. What is Israel's dwelling place?

  5. How do believers share this security?

Crossword

42351

Across

  1. Underneath are the everlasting ____.
  2. The eternal God is your ____ place.
  3. You are ____, Israel!

Down

  1. Benjamin will dwell in ____.
  2. God came from ____.

Think About It

  1. What would it change for you to think of God Himself as your home?

  2. Why is it significant that the law is called an inheritance and a sign of God's love?

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Copy It

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do Moses' blessings show God's care for each tribe?
  • How can you bless someone with your words?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.