The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 33

Prints on letter paper in black and white. No answers are printed on the student sheet.

Deuteronomy 33 · Grade 3

The Everlasting Arms

Name Date

Read the Story

Moses, the man of God, blessed Israel before his death. He said God came from Sinai and gave them the law. Moses commanded the law as an inheritance for Israel.

He blessed each tribe. Levi would teach God's ordinances and offer incense. Benjamin, the beloved of Yahweh, would dwell in safety. Joseph's land would be blessed with dew, the sun, and the best of the ancient mountains.

Moses ended with praise. There is no one like God, who rides on the heavens to help. The eternal God is your dwelling place. Underneath are the everlasting arms. You are happy, Israel! Who is like you, a people saved by Yahweh?

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Answer the Questions

  1. Where did God come from to give the law?

  2. What would Levi teach?

  3. Who would dwell in safety?

  4. What is underneath God's people?

  5. Who is like Israel?

Moses' Blessing

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

JAATWIFOKLBLARMSTUUJLEHIRPFSIUEVABVBTASDSIPEREYFIASVPSYIAENHIFYLYWPTANNPSCUFNYIOG
  • BLESSING
  • SAFETY
  • TRIBES
  • SINAI
  • JUDAH
  • HAPPY
  • ARMS
  • LEVI

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • When do you need to feel God holding you?
  • Why is God called a dwelling place?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.