The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 33

Prints on letter paper in black and white. No answers are printed on the student sheet.

Deuteronomy 33 · Grade 2

Underneath Are His Arms

Name Date

Read the Story

Before Moses died, he blessed the people. He gave a blessing to each family of Israel.

He said, Benjamin is loved by God. He will live safe with God. God covers him all day long. Moses blessed the other families too.

At the end Moses said, There is no one like our God. God is your home. Under you are His arms that last forever. You are happy, Israel. God has saved you.

Memory Verse

“The eternal God is your dwelling place. Underneath are the everlasting arms. He thrust out the enemy from before you, and said, ‘Destroy!’”

Deuteronomy 33:27 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. When did Moses bless the people?

    God has saved themEach family of IsraelBefore he died

  2. Who did Moses bless?

    Each family of IsraelGod has saved themBefore he died

  3. Who is loved by God?

    BenjaminBefore he diedEach family of Israel

  4. What is under you?

  5. Why is Israel happy?

    BenjaminGod has saved themBefore he died

Word Search

Find and circle each word. Words go across and down.

BVTRIBESHBNHJUDAHIRLAAVADIVASESINAIHRPASLADGAMDDFSEHVPSFRTEIVGPNVPPKTNIYVBIOOTYGH
  • BLESSING
  • SAFETY
  • TRIBES
  • SINAI
  • JUDAH
  • HAPPY
  • ARMS
  • LEVI

Prayer

Dear God, thank You for holding me. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who could you speak a kind blessing to today?
  • What does it mean that God is our home?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.