The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 1

For teachers and parents. Prints separately from the student sheets.

Deuteronomy 1 · For teachers and parents

Answer Key: Moses Remembers the Journey

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Carries Me

peopletentgrapesmountainscroll

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenDo Not Be Afraid

WORDS → picture 3PEOPLE → picture 1FRUIT → picture 4TENT → picture 2

Grade 1God Goes First

Moses spoke God's words. → picture 4Wise men helped judge the people. → picture 3The spies brought back fruit. → picture 1The people were afraid. → picture 5They went back to the wilderness. → picture 2

Order:

1. Moses speaks to Israel2. Leaders are chosen3. Spies bring back fruit4. The people do not trust God

Grade 2A Long Trip

  1. Where were the people? Near the Jordan River (circle)
  2. Who helped Moses lead? Wise men (circle)
  3. What did the twelve men bring back? Fruit (circle)
  4. Why did the people not go in? They were afraid and did not trust God.
  5. How did God carry them? Like a man carries his son
JLMOSESDVYCAPTAINSSHILLSPMNPWCARRIEDSRJUDGESUYFRUITKGOKWDHRIVEUUAFRAIDCDGFFCSPIED

Grade 3Remember the Way

  1. Where was Moses when he spoke? Beyond the Jordan in the land of Moab
  2. Why did Moses choose judges? The people were too many for him alone.
  3. What did the spies bring back? Fruit from the good land
  4. What did the people fail to do? They did not believe God and would not go up.
  5. Who would still enter the land? Caleb and Joshua
1: Moses speaks to Israel2: Leaders are chosen3: Spies bring back fruit4: The people do not trust God

Grade 4Fear or Faith

  1. What does Deuteronomy mean? A second telling of the law
  2. Who was Moses speaking to? A new generation in the land of Moab
  3. Why should judges not be afraid of anyone? Judgment belongs to God.
  4. What went wrong at Kadesh Barnea? The people refused to trust God and go up.

Word bank: 1. Moses; 2. judges; 3. afraid; 4. good; 5. carried

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The God Who Carries

  1. Where did Moses give these speeches? On the plains of Moab before Israel crossed the Jordan
  2. Who were most of the listeners? The children of those who had left Egypt
  3. How were the judges to treat people? The same, showing no favoritism, because judgment is God's
  4. What did the people wrongly imagine at Kadesh? That God hated them
  5. What kept that generation out of the land? Unbelief, not weakness
3JUDGE4S2FRIT1ARAIDPIED5CARRIE

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.