The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Every grade prints starting on a new page. No answers are included.

Deuteronomy 1 · Preschool

God Carries Me

Name Date

Color Moses and the people! God carried His people like a dad carries his child.

Can you find these in the picture? Circle each one!

Bible Verse

Then I said to you, “Don’t be terrified. Don’t be afraid of them.

Deuteronomy 1:29 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God took care of His people on the long trip. He takes care of you too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Kindergarten

Do Not Be Afraid

Name Date

Trace the Words

Trace each word with your pencil.

GOD
CARE
LAND
TRUST
Then I said to you, “Don’t be terrified. Don’t be afraid of them.

Deuteronomy 1:29 (WEB)

Match the Pictures

Draw a line from each word to its picture.

WORDS
PEOPLE
FRUIT
TENT

Mini Maze

Help find the way through the maze.

Draw It

Draw a time God took care of you.

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • When do you feel scared?
  • Who carries you when you are tired?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Grade 1

God Goes First

Name Date

Trace the Words

Trace the words and the verse.

FEAR
TRUST
SPIES
LAND
Then I said to you, “Don’t be terrified. Don’t be afraid of them.

Deuteronomy 1:29 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Moses spoke God's words.
Wise men helped judge the people.
The spies brought back fruit.
The people were afraid.
They went back to the wilderness.

Moses Remembers

Write the number 1 to 4 in each circle to show the right order.

Leaders are chosen

Moses speaks to Israel

Spies bring back fruit

The people do not trust God

Draw a time God took care of you.

Memory Verse

Then I said to you, “Don’t be terrified. Don’t be afraid of them.

Deuteronomy 1:29 (WEB)

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who chose good helpers for Moses?
  • What did the men bring back from the land?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Grade 2

A Long Trip

Name Date

Read the Story

Moses talked to God's people. They were near the Jordan River. He told them about their long trip.

God said it was time to go to the good land. Moses chose wise men to help him lead. Twelve men went to look at the land. They came back with fruit. They said the land was good.

But the people were afraid. They did not trust God. Moses said God would fight for them. He said God carried them like a man carries his son. But they still did not go. So they had to turn back.

Memory Verse

Behold, Yahweh your God has set the land before you. Go up, take possession, as Yahweh the God of your fathers has spoken to you. Don’t be afraid, neither be dismayed.”

Deuteronomy 1:21 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where were the people?

    FruitWise menNear the Jordan River

  2. Who helped Moses lead?

    Wise menLike a man carries his sonNear the Jordan River

  3. What did the twelve men bring back?

    Near the Jordan RiverWise menFruit

  4. Why did the people not go in?

  5. How did God carry them?

Word Search

Find and circle each word. Words go across and down.

JLMOSESDVYCAPTAINSSHILLSPMNPWCARRIEDSRJUDGESUYFRUITKGOKWDHRIVEUUAFRAIDCDGFFCSPIED
  • CAPTAINS
  • CARRIED
  • JUDGES
  • AFRAID
  • MOSES
  • SPIED
  • FRUIT
  • HILLS

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you feel when you remember a time God helped you?
  • How can you remember that God goes ahead of you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Grade 3

Remember the Way

Name Date

Read the Story

Deuteronomy begins with Moses speaking to all Israel. They were camped beyond the Jordan in the land of Moab. Moses began to explain God's law and to remind them of their journey.

At Horeb, God told them they had stayed at the mountain long enough. The people had grown as many as the stars. Moses chose wise men from each tribe to be judges. He told them to judge fairly, for the judgment is God's.

Twelve spies saw the good land and brought back fruit. But the people grumbled and would not go up. They did not believe God, who had carried them through the wilderness. So that whole group would not enter the land, except Caleb and Joshua.

Memory Verse

Behold, Yahweh your God has set the land before you. Go up, take possession, as Yahweh the God of your fathers has spoken to you. Don’t be afraid, neither be dismayed.”

Deuteronomy 1:21 (WEB)

Answer the Questions

  1. Where was Moses when he spoke?

  2. Why did Moses choose judges?

  3. What did the spies bring back?

  4. What did the people fail to do?

  5. Who would still enter the land?

Moses Remembers

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Moses say God would do for them?
  • When is it hard for you to trust God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Grade 4

Fear or Faith

Name Date

Read and Think

Deuteronomy means a second telling of the law. Forty years after leaving Egypt, Moses spoke to a new generation in the land of Moab. He started by retelling their story so they would not repeat their parents' mistakes.

Moses had shared the work of leading by choosing wise and respected men as judges. He told them to hear small and great alike, and not to be afraid of anyone, because judgment belongs to God.

At Kadesh Barnea, the spies reported a good land, but the people refused to go up. Moses reminded them that God goes before them and carried them as a father carries his son. Still they did not trust Him, and that generation had to wander in the wilderness.

Show What You Know

  1. What does Deuteronomy mean?

  2. Who was Moses speaking to?

  3. Why should judges not be afraid of anyone?

  4. What went wrong at Kadesh Barnea?

Word Bank Fill-In

Use the word bank to fill in each blank.

carriedafraidjudgesgoodMoses
  1. Forty years after leaving Egypt, spoke to a new generation in the land of Moab.
  2. Moses had shared the work of leading by choosing wise and respected men as .
  3. He told them to hear small and great alike, and not to be of anyone, because judgment belongs to God.
  4. At Kadesh Barnea, the spies reported a land, but the people refused to go up.
  5. Moses reminded them that God goes before them and them as a father carries his son.

Think About It

  1. When have you been afraid to do what God asked?

  2. How has God carried you through a hard time?

Memory Verse

Behold, Yahweh your God has set the land before you. Go up, take possession, as Yahweh the God of your fathers has spoken to you. Don’t be afraid, neither be dismayed.”

Deuteronomy 1:21 (WEB)

Copy It

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is unbelief so serious in this chapter?
  • What helps you trust God when something looks too big?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Deuteronomy 1 · Grade 5

The God Who Carries

Name Date

Read and Think

Deuteronomy is made of speeches Moses gave on the plains of Moab, just before Israel crossed the Jordan. The people listening were mostly the children of those who had left Egypt. Moses opened by reviewing the forty years, beginning at Horeb, where God said it was time to move on toward the land He had promised Abraham, Isaac, and Jacob.

As the nation grew, Moses could not bear their burdens alone. He appointed wise, understanding, and respected leaders as judges. They were to treat the foreigner and the Israelite the same and to show no favoritism, because the judgment is God's.

The saddest memory came from Kadesh Barnea. The spies brought fruit and said the land was good, yet the people rebelled, imagining that God hated them. Moses reminded them that God had carried them through the wilderness like a father carrying his son, going before them in fire by night and cloud by day. Unbelief, not weakness, kept that generation out.

Show What You Know

  1. Where did Moses give these speeches?

  2. Who were most of the listeners?

  3. How were the judges to treat people?

  4. What did the people wrongly imagine at Kadesh?

  5. What kept that generation out of the land?

Crossword

34215

Across

  1. Do not be ____.
  2. They must judge fairly.
  3. God ____ you as a man carries his son.

Down

  1. The men brought back the ____ of the land.
  2. Twelve men ____ out the land.

Think About It

  1. Moses retold the past so the next generation would learn. What can you learn from mistakes in your family or church story?

  2. God carried Israel like a father carries his son. How does that picture help you trust Him today?

Memory Verse

Behold, Yahweh your God has set the land before you. Go up, take possession, as Yahweh the God of your fathers has spoken to you. Don’t be afraid, neither be dismayed.”

Deuteronomy 1:21 (WEB)

Copy It

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God carrying Israel like a son shape how you see Him?
  • What step of faith might God be asking of you now?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.