The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Prints on letter paper in black and white. No answers are printed on the student sheet.

Deuteronomy 1 · Grade 2

A Long Trip

Name Date

Read the Story

Moses talked to God's people. They were near the Jordan River. He told them about their long trip.

God said it was time to go to the good land. Moses chose wise men to help him lead. Twelve men went to look at the land. They came back with fruit. They said the land was good.

But the people were afraid. They did not trust God. Moses said God would fight for them. He said God carried them like a man carries his son. But they still did not go. So they had to turn back.

Memory Verse

Behold, Yahweh your God has set the land before you. Go up, take possession, as Yahweh the God of your fathers has spoken to you. Don’t be afraid, neither be dismayed.”

Deuteronomy 1:21 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where were the people?

    FruitWise menNear the Jordan River

  2. Who helped Moses lead?

    Wise menLike a man carries his sonNear the Jordan River

  3. What did the twelve men bring back?

    Near the Jordan RiverWise menFruit

  4. Why did the people not go in?

  5. How did God carry them?

Word Search

Find and circle each word. Words go across and down.

JLMOSESDVYCAPTAINSSHILLSPMNPWCARRIEDSRJUDGESUYFRUITKGOKWDHRIVEUUAFRAIDCDGFFCSPIED
  • CAPTAINS
  • CARRIED
  • JUDGES
  • AFRAID
  • MOSES
  • SPIED
  • FRUIT
  • HILLS

Prayer

Dear God, thank You for carrying me like a father. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you feel when you remember a time God helped you?
  • How can you remember that God goes ahead of you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.