The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 8

For teachers and parents. Prints separately from the student sheets.

2 Kings 8 · For teachers and parents

Answer Key: The Shunammite's Land and Hazael

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Lamp for David

crownhousepersonlamp

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Keeps Promises

LAMP → picture 2HOME → picture 4KING → picture 1FIELD → picture 3

Grade 1God Remembers

The woman went away. → picture 2She came back home. → picture 4The king gave back her land. → picture 5She got her fields back. → picture 1God kept a lamp for David. → picture 3

Order:

1. It will also come on the land for seven years2. And this is her son3. So the king appointed to her a certain officer4. Yahweh would not destroy Judah

Grade 2God Gives Back

  1. Why did the woman go away? A famine was coming. (circle)
  2. How long was she gone? Seven years (circle)
  3. What did she ask the king for? Her house and land (circle)
  4. Who was telling the king about her son? Gehazi (circle)
  5. Whose promise did God keep? David's (circle)
HKMLANDEBAWRGDGADEZDAVIDPANAGWLEFIMTEELISHAAGLHLAMPSSVFFAMINECVFSAUEMWUOIJUDAHJSC

Grade 3Right on Time

  1. How long was the famine? Seven years
  2. Where did the woman live? In the land of the Philistines
  3. What did the king give back? Her land and all its crops
  4. Why did Elisha cry? Hazael would do great harm to Israel.
  5. Why did God not destroy Judah? He kept a lamp for David's children.
1: It will also come on the land for seven years2: And this is her son3: So the king appointed to her a certain officer4: Yahweh would not destroy Judah
WJLMLMEDUHRUEBPLAHABODRJIMLZPPDAWSAAAJLICHHSMELANDEACPLFAMINEUKEWIDKOHSODAVIDKMGM

Grade 4God's Timing and God's Promise

  1. Where did the woman go during the famine? The land of the Philistines
  2. What was the king asking Gehazi at that moment? To tell all the great things Elisha had done
  3. How many camel loads of gifts did Hazael bring? Forty
  4. Whose daughter did Jehoram of Judah marry? Ahab's daughter

Word bank: 1. Elisha; 2. land; 3. Damascus; 4. Hazael

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Providence and Promise

  1. Why was the woman's timing no accident? God arranged it so her testimony confirmed the miracle.
  2. Where had God told Elijah about Hazael? At Horeb, in 1 Kings 19:15
  3. Whom did Jehoram of Judah marry? Athaliah, Ahab's daughter
  4. What is Jesus called in Revelation 22:16 in the New Testament? The root and offspring of David, the bright morning star
3HAZAE4L2DMASCUS1FMINEAND5ELIHA

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.