The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Every grade prints starting on a new page. No answers are included.

2 Kings 8 · Preschool

A Lamp for David

Name Date

Color the lamp. God kept His promise to David.

Can you find these in the picture? Circle each one!

Bible Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God promised David a lamp for his family. God always keeps His promises.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Kindergarten

God Keeps Promises

Name Date

Trace the Words

Trace each word with your pencil.

LAMP
LAND
HOME
KEEP
However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.

2 Kings 8:19 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LAMP
HOME
KING
FIELD

Mini Maze

Help find the way through the maze.

Draw It

Draw a lamp that keeps burning.

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who went away during the famine?
  • What did the king give back?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Grade 1

God Remembers

Name Date

Trace the Words

Trace the words and the verse.

LAND
HOME
LAMP
PROMISE
However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.

2 Kings 8:19 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The woman went away.
She came back home.
The king gave back her land.
She got her fields back.
God kept a lamp for David.

God Keeps Promises

Write the number 1 to 4 in each circle to show the right order.

It will also come on the land for seven years

And this is her son

Yahweh would not destroy Judah

So the king appointed to her a certain officer

Draw a lamp that keeps burning.

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did God keep for David?
  • Does God keep His promises?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Grade 2

God Gives Back

Name Date

Read the Story

Elisha told the kind woman to go away. A famine was coming. She went to live in another land for seven years.

She came home. She asked the king for her house and land. Right then, Gehazi was telling the king about her son. Elisha had brought her son back to life. The king gave back all her land.

Some kings of Judah did evil. But God kept His promise to David. He would not destroy Judah. He kept a lamp for David's family.

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Why did the woman go away?

    A famine was comingDavid'sHer house and land

  2. How long was she gone?

    Her house and landSeven yearsGehazi

  3. What did she ask the king for?

    David'sA famine was comingHer house and land

  4. Who was telling the king about her son?

    GehaziA famine was comingSeven years

  5. Whose promise did God keep?

    A famine was comingGehaziDavid's

Word Search

Find and circle each word. Words go across and down.

HKMLANDEBAWRGDGADEZDAVIDPANAGWLEFIMTEELISHAAGLHLAMPSSVFFAMINECVFSAUEMWUOIJUDAHJSC
  • DAMASCUS
  • ELISHA
  • FAMINE
  • HAZAEL
  • JUDAH
  • DAVID
  • LAND
  • LAMP

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God when you have to move away?
  • How can you trust God's timing?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Grade 3

Right on Time

Name Date

Read the Story

Elisha told the Shunammite woman to leave. The Lord had called for a famine of seven years. She lived in the land of the Philistines. After seven years she came back. She went to the king to ask for her house and land.

Right then, Gehazi was telling the king how Elisha gave life to a dead boy. The woman came in, and Gehazi said this was the woman and her son. The king gave back her land and all its crops from those years.

Elisha went to Damascus. Ben Hadad was sick and sent Hazael to ask if he would get well. Elisha cried. He said Hazael would be king and do great harm to Israel. Hazael went back and took the throne. In Judah, Jehoram did evil like Ahab's family. But God would not destroy Judah. He kept a lamp for David's children.

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Answer the Questions

  1. How long was the famine?

  2. Where did the woman live?

  3. What did the king give back?

  4. Why did Elisha cry?

  5. Why did God not destroy Judah?

God Keeps Promises

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WJLMLMEDUHRUEBPLAHABODRJIMLZPPDAWSAAAJLICHHSMELANDEACPLFAMINEUKEWIDKOHSODAVIDKMGM
  • DAMASCUS
  • ELISHA
  • FAMINE
  • HAZAEL
  • JUDAH
  • DAVID
  • LAND
  • LAMP

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How has God helped you when something was lost?
  • How can you remember God's promises?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Grade 4

God's Timing and God's Promise

Name Date

Read and Think

Elisha warned the Shunammite woman whose son he had restored that the Lord had called for a seven-year famine. She went with her household to the land of the Philistines. When she returned, she went to the king to appeal for her house and land.

At that very moment, the king was asking Gehazi to tell all the great things Elisha had done. As Gehazi told how Elisha had restored the dead boy to life, the woman came in. The king asked her, and she told him. He appointed an officer to restore all that was hers, including the produce of the fields since she left.

Elisha went to Damascus, where Ben Hadad was sick. Hazael brought forty camel loads of gifts to ask if the king would recover. Elisha stared at him until Hazael was ashamed, and then wept. He said Hazael would become king and bring terrible harm on Israel. Hazael returned, smothered Ben Hadad with a wet cloth, and reigned. In Judah, Jehoram son of Jehoshaphat married Ahab's daughter and did evil. Yet the Lord would not destroy Judah, for David's sake, as He promised to give him a lamp always.

Show What You Know

  1. Where did the woman go during the famine?

  2. What was the king asking Gehazi at that moment?

  3. How many camel loads of gifts did Hazael bring?

  4. Whose daughter did Jehoram of Judah marry?

Word Bank Fill-In

Use the word bank to fill in each blank.

DamascusElishaHazaelland
  1. warned the Shunammite woman whose son he had restored that the Lord had called for a seven-year famine.
  2. She went with her household to the of the Philistines.
  3. Elisha went to , where Ben Hadad was sick.
  4. brought forty camel loads of gifts to ask if the king would recover.

Think About It

  1. The woman arrived at exactly the right moment. Where have you seen God's timing in your life?

  2. God kept His lamp burning for David even when kings failed. How does God's faithfulness give you hope?

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Copy It

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How long did the famine last?
  • How can you care about people who might be hurt?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 8 · Grade 5

Providence and Promise

Name Date

Read and Think

The Shunammite woman's story shows God's quiet providence. She obeyed Elisha's warning and left during a famine. Seven years later, she returned to appeal for her land at the very moment Gehazi was telling the king about her son's resurrection. The timing was no accident. God arranged it so that her testimony confirmed the miracle and her property was restored.

In Damascus, Elisha met Hazael and wept. God had already told Elijah at Horeb that Hazael would be anointed over Syria (1 Kings 19:15). Elisha foresaw the suffering Hazael would bring on Israel. Hazael pretended humility, calling himself a dog, but went home, smothered Ben Hadad, and seized the throne. God's foreknowledge did not excuse Hazael's evil. He chose it.

Judah's kings were sliding toward Ahab's ways. Jehoram married Athaliah, Ahab's daughter, and walked in the ways of Israel's kings. His son Ahaziah followed. Edom and Libnah revolted. Yet one verse holds the line: the Lord would not destroy Judah, for David's sake, to give him a lamp always. That lamp would finally shine in David's greatest Son. In the New Testament, Jesus is called the root and offspring of David, the bright morning star (Revelation 22:16).

Show What You Know

  1. Why was the woman's timing no accident?

  2. Where had God told Elijah about Hazael?

  3. Whom did Jehoram of Judah marry?

  4. What is Jesus called in Revelation 22:16 in the New Testament?

Crossword

34215

Across

  1. When he fought against ____ king of Syria.
  2. What did ____ say to you.

Down

  1. For Yahweh has called for a ____.
  2. Even of every good thing of ____.
  3. The woman returned from the ____ of the Philistines.

Think About It

  1. God's foreknowledge did not excuse Hazael's choices. How does this help you take responsibility for your own choices?

  2. In the New Testament, David's lamp shines in Jesus. How does knowing God keeps His promises help you trust Him?

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Copy It

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you do when you feel sad about something wrong you did?
  • Who is the root and offspring of David?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.