The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Prints on letter paper in black and white. No answers are printed on the student sheet.

2 Kings 8 · Grade 2

God Gives Back

Name Date

Read the Story

Elisha told the kind woman to go away. A famine was coming. She went to live in another land for seven years.

She came home. She asked the king for her house and land. Right then, Gehazi was telling the king about her son. Elisha had brought her son back to life. The king gave back all her land.

Some kings of Judah did evil. But God kept His promise to David. He would not destroy Judah. He kept a lamp for David's family.

Memory Verse

“However, Yahweh would not destroy Judah, for David his servant’s sake, as he promised him to give to him a lamp for his children always.”

2 Kings 8:19 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Why did the woman go away?

    A famine was comingDavid'sHer house and land

  2. How long was she gone?

    Her house and landSeven yearsGehazi

  3. What did she ask the king for?

    David'sA famine was comingHer house and land

  4. Who was telling the king about her son?

    GehaziA famine was comingSeven years

  5. Whose promise did God keep?

    A famine was comingGehaziDavid's

Word Search

Find and circle each word. Words go across and down.

HKMLANDEBAWRGDGADEZDAVIDPANAGWLEFIMTEELISHAAGLHLAMPSSVFFAMINECVFSAUEMWUOIJUDAHJSC
  • DAMASCUS
  • ELISHA
  • FAMINE
  • HAZAEL
  • JUDAH
  • DAVID
  • LAND
  • LAMP

Prayer

Dear God, thank You for keeping Your promises. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God when you have to move away?
  • How can you trust God's timing?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.