The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 7

For teachers and parents. Prints separately from the student sheets.

2 Kings 7 · For teachers and parents

Answer Key: Good News from Four Lepers

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolShare Good News

tentdonkeypersoncity

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGood News

TENT → picture 4FOOD → picture 3GATE → picture 1BASKET → picture 2

Grade 1The Four Men

Four men sat by the gate. → picture 5The tents were empty. → picture 1They found food. → picture 4They chose to share. → picture 2Food filled the city. → picture 3

Order:

1. And two seahs of barley for a shekel2. Now there were four leprous men at the entrance of the gate3. When these lepers came to the outermost part of the camp4. The people went out and plundered the camp of the Syrians

Grade 2The Empty Camp

  1. What did the city not have? Food (circle)
  2. Who did not believe Elisha? One officer (circle)
  3. Where did the four men go? The enemy camp (circle)
  4. Why did the enemy run away? God made them hear a big army.
  5. What did the men say was wrong? To keep this good news
YWMOFEODDSGCSLGUVPDDTAOOSKKFJEMULBCNDWNAREAADHNTRGPRMSFESIAELPAWWVATRELKOSFSESYWE

Grade 3A Day of Good News

  1. Why did Samaria have no food? The Syrian army was around it.
  2. What did the officer say? That could not happen even if God opened windows in heaven.
  3. What did God make the Syrians hear? Chariots and horses
  4. What did the men say this day was? A day of good news
  5. What was the road full of? Things the Syrians dropped
1: And two seahs of barley for a shekel2: Now there were four leprous men at the entrance of the gate3: When these lepers came to the outermost part of the camp4: The people went out and plundered the camp of the Syrians

Grade 4We Are Not Doing Right

  1. What did the officer scoff? Even if the Lord made windows in heaven, this could not happen.
  2. Whom did the Syrians think Israel had hired? The Hittites and Egyptians
  3. What did the king fear? A trap
  4. What happened to the officer? He was trampled in the gate and died.

Word bank: 1. gate; 2. camp; 3. tents; 4. lepers; 5. news

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5A Day of Good News

  1. What sentence did the officer's unbelief bring? He would see God's provision but not share in it.
  2. Why were the lepers unlikely messengers? They were outcasts who lived outside the gate by law.
  3. How was the battle won? The Lord caused the Syrians to hear a great army, without a single Israelite soldier.
  4. What does Paul ask in Romans 10:14 in the New Testament? How people can believe in Him of whom they have not heard
5SAMARIA3LEPES1TENT2FOUR4CAP

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.