The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Every grade prints starting on a new page. No answers are included.

2 Kings 7 · Preschool

Share Good News

Name Date

Color the four men finding food in the empty tents. They shared the good news.

Can you find these in the picture? Circle each one!

Bible Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: The men found food and told everyone. We can share good news about God too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Kindergarten

Good News

Name Date

Trace the Words

Trace each word with your pencil.

NEWS
FOOD
TENT
SHARE
Now there were four leprous men at the entrance of the gate. They said to one another, “Why do we sit here until we die?

2 Kings 7:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

TENT
FOOD
GATE
BASKET

Mini Maze

Help find the way through the maze.

Draw It

Draw yourself sharing good news.

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who found the empty camp?
  • What did they find?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Grade 1

The Four Men

Name Date

Trace the Words

Trace the words and the verse.

EMPTY
TENTS
FOOD
SHARE
Now there were four leprous men at the entrance of the gate. They said to one another, “Why do we sit here until we die?

2 Kings 7:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Four men sat by the gate.
The tents were empty.
They found food.
They chose to share.
Food filled the city.

Good News

Write the number 1 to 4 in each circle to show the right order.

Now there were four leprous men at the entrance of the gate

And two seahs of barley for a shekel

When these lepers came to the outermost part of the camp

The people went out and plundered the camp of the Syrians

Draw yourself sharing good news.

Memory Verse

Now there were four leprous men at the entrance of the gate. They said to one another, “Why do we sit here until we die?

2 Kings 7:3 (WEB)

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • Whom did they tell?
  • How can you share good news?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Grade 2

The Empty Camp

Name Date

Read the Story

The city had no food. Elisha said that tomorrow there would be lots of food. One officer did not believe him.

Four sick men sat by the gate. They went to the enemy camp. No one was there! God had made the enemy hear a big army. They ran away and left their food.

The men ate and drank. Then they said it was wrong to keep this good news. They told the city. Everyone had food, just as Elisha said.

Memory Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did the city not have?

    The enemy campFoodOne officer

  2. Who did not believe Elisha?

    One officerThe enemy campFood

  3. Where did the four men go?

    To keep this good newsFoodThe enemy camp

  4. Why did the enemy run away?

  5. What did the men say was wrong?

Word Search

Find and circle each word. Words go across and down.

YWMOFEODDSGCSLGUVPDDTAOOSKKFJEMULBCNDWNAREAADHNTRGPRMSFESIAELPAWWVATRELKOSFSESYWE
  • SAMARIA
  • LEPERS
  • BARLEY
  • TENTS
  • FLOUR
  • CAMP
  • GATE
  • NEWS

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help others when you have more than enough?
  • How can you tell someone about Jesus?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Grade 3

A Day of Good News

Name Date

Read the Story

Samaria had no food because the Syrian army was around it. Elisha said that by tomorrow, flour and barley would be cheap. An officer said that could not happen even if God opened windows in heaven. Elisha said he would see it but not eat it.

Four men with leprosy sat at the gate. They said they would die if they stayed. So they went to the Syrian camp at dusk. No one was there! God had made the Syrians hear chariots and horses. They thought kings were coming to fight. They ran and left their tents, food, and silver.

The men ate and hid some treasure. Then they said they were not doing right. This was a day of good news. They told the gatekeepers. The king sent men to look. The road was full of things the Syrians dropped. Food was cheap, just as Elisha said. The officer saw it, but he did not eat it.

Memory Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Answer the Questions

  1. Why did Samaria have no food?

  2. What did the officer say?

  3. What did God make the Syrians hear?

  4. What did the men say this day was?

  5. What was the road full of?

Good News

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you thank God when He gives you what you need?
  • How can you believe God's promises?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Grade 4

We Are Not Doing Right

Name Date

Read and Think

During the siege of Samaria, Elisha announced God's word: by this time tomorrow, fine flour and barley would sell for a shekel at the gate. The king's officer scoffed that even if the Lord made windows in heaven, this could not happen. Elisha told him he would see it with his own eyes but not eat of it.

Four men with leprosy at the gate reasoned that they would die whether they stayed or went. At twilight they went to the Syrian camp and found it empty. The Lord had made the Syrians hear the noise of chariots, horses, and a great army. They thought Israel had hired the Hittites and Egyptians, and they fled for their lives, leaving tents, horses, and donkeys.

The lepers ate, drank, and hid silver, gold, and clothing. Then they said to one another that they were not doing right. This was a day of good news, and they were keeping silent. They told the gatekeepers. The king feared a trap, but scouts found the road to the Jordan full of garments the Syrians had thrown away. The people plundered the camp, and food sold at the very price Elisha had said. The officer was trampled in the gate and died, as the man of God had said.

Show What You Know

  1. What did the officer scoff?

  2. Whom did the Syrians think Israel had hired?

  3. What did the king fear?

  4. What happened to the officer?

Word Bank Fill-In

Use the word bank to fill in each blank.

newsleperstentsgatecamp
  1. Four men with leprosy at the reasoned that they would die whether they stayed or went.
  2. At twilight they went to the Syrian and found it empty.
  3. They thought Israel had hired the Hittites and Egyptians, and they fled for their lives, leaving , horses, and donkeys.
  4. The ate, drank, and hid silver, gold, and clothing.
  5. This was a day of good , and they were keeping silent.

Think About It

  1. The lepers said keeping good news to themselves was not right. In the New Testament, Jesus sends His followers to share good news. Who can you tell?

  2. The officer doubted God's word. How can you choose to believe God's promises?

Memory Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Copy It

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • How might God use you even if you feel left out?
  • What did the four men say was not right?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Kings 7 · Grade 5

A Day of Good News

Name Date

Read and Think

Samaria was in desperate famine. Elisha announced that within a day food would be cheap. The king's officer mocked, saying even windows in heaven could not bring such a thing. His unbelief earned a sober sentence: he would see God's provision but not share in it.

God's deliverance came through the least likely people. Four outcast lepers, who lived outside the gate by law, decided to go to the enemy camp. They found it abandoned. The Lord had caused the Syrians to hear the sound of a great army, and they fled in panic. God won the battle without a single Israelite soldier.

After feasting, the lepers were struck by conscience. They said they were not doing right; this was a day of good news, and they were keeping silent. They brought the news to the city, and the famine ended exactly as God had spoken. The officer who scoffed was trampled at the gate. God's word proved true in mercy and in judgment. In the New Testament, Paul asks how people can believe in Him of whom they have not heard, and how they can hear without someone preaching (Romans 10:14).

Show What You Know

  1. What sentence did the officer's unbelief bring?

  2. Why were the lepers unlikely messengers?

  3. How was the battle won?

  4. What does Paul ask in Romans 10:14 in the New Testament?

Crossword

53124

Across

  1. And a seah of fine ____ for a shekel.
  2. In the gate of ____.

Down

  1. And the ____ as they were.
  2. When these ____ came to the outermost part of the camp.
  3. We came to the ____ of the Syrians.

Think About It

  1. The lepers were outcasts, yet God used them to save a city. How can God use you even if you feel small?

  2. Like the lepers, Christians have good news to share. What keeps you silent, and how can you overcome it?

Memory Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Copy It

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did God win without soldiers?
  • What does Romans 10:14 say about hearing the gospel?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.