The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Prints on letter paper in black and white. No answers are printed on the student sheet.

2 Kings 7 · Grade 2

The Empty Camp

Name Date

Read the Story

The city had no food. Elisha said that tomorrow there would be lots of food. One officer did not believe him.

Four sick men sat by the gate. They went to the enemy camp. No one was there! God had made the enemy hear a big army. They ran away and left their food.

The men ate and drank. Then they said it was wrong to keep this good news. They told the city. Everyone had food, just as Elisha said.

Memory Verse

Then they said to one another, “We aren’t doing right. Today is a day of good news, and we keep silent. If we wait until the morning light, punishment will overtake us. Now therefore come, let’s go and tell the king’s household.”

2 Kings 7:9 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did the city not have?

    The enemy campFoodOne officer

  2. Who did not believe Elisha?

    One officerThe enemy campFood

  3. Where did the four men go?

    To keep this good newsFoodThe enemy camp

  4. Why did the enemy run away?

  5. What did the men say was wrong?

Word Search

Find and circle each word. Words go across and down.

YWMOFEODDSGCSLGUVPDDTAOOSKKFJEMULBCNDWNAREAADHNTRGPRMSFESIAELPAWWVATRELKOSFSESYWE
  • SAMARIA
  • LEPERS
  • BARLEY
  • TENTS
  • FLOUR
  • CAMP
  • GATE
  • NEWS

Prayer

Dear God, thank You for good news. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help others when you have more than enough?
  • How can you tell someone about Jesus?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.