The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 13

For teachers and parents. Prints separately from the student sheets.

2 Chronicles 13 · For teachers and parents

Answer Key: God Is with Us

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolTrust God

trumpetcrownscrollfamilypeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenTrust

HORN → picture 3KING → picture 1LAMP → picture 4MOUNTAIN → picture 2

Grade 1God Is with Us

Abijah stood on a mountain. → picture 4Judah kept God's lamps lit. → picture 3They cried to God. → picture 1The priests blew horns. → picture 5God helped them. → picture 2

Order:

1. Now you intend to withstand the kingdom of Yahweh in the hand of the sons of David2. Haven’t you driven out the priests of Yahweh3. We have priests serving Yahweh, the sons of Aaron, and the Levites in their work4. Behold, God is with us at our head

Grade 2They Trusted God

  1. Who was king of Judah? Abijah (circle)
  2. Where did Abijah stand? On a mountain (circle)
  3. What did Abijah say? God is with us! (circle)
  4. What did Judah do when they were in trouble? They cried out to God.
  5. Why did God help Judah? They trusted Him. (circle)
FTDAVIDHRAPRIESTSIBJUDAHMYFIGACHOSENJEROBOAMLANYAHWEHYHISRAELFNCYTTRDHPLUHJSSNUML

Grade 3Relying on Yahweh

  1. How big was Jeroboam's army? Twice as big as Judah's
  2. Where did Abijah stand? On Mount Zemaraim
  3. What did Israel have instead of God? Golden calves and false priests
  4. What did Judah light every evening? The gold lamp
  5. Why did God give Judah the victory? They relied on Yahweh.
1: Now you intend to withstand the kingdom of Yahweh in the hand of the sons of David2: Haven’t you driven out the priests of Yahweh3: We have priests serving Yahweh, the sons of Aaron, and the Levites in their work4: Behold, God is with us at our head
DISRAELDTAADDULYKGSBVWUSACPJNIICYHHRULHJDAWOIDJKWACESEANTWEHHESHVWUWBHNTJEROBOAMS

Grade 4Do Not Fight Against God

  1. How many men did each side have? Four hundred thousand against eight hundred thousand
  2. By what kind of covenant was the kingdom given to David? A covenant of salt
  3. What had Jeroboam made for gods? Golden calves
  4. What did Judah do when surrounded? They cried to Yahweh, the priests sounded the trumpets, and they shouted.
  5. Why did Judah prevail? They relied on Yahweh.

Word bank: 1. Jeroboam; 2. Abijah; 3. Yahweh; 4. priests; 5. Israel

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Outnumbered but Not Alone

  1. How long did Abijah reign? Three years
  2. What did a covenant of salt mean? A covenant meant to last
  3. How could anyone become a priest in Israel? By bringing an offering
  4. What explains Judah's victory? They relied on Yahweh.
  5. What does Paul ask in Romans 8:31? In the New Testament, if God is for us, who can be against us?
4JEROBOAMUDAH2AIJAH1ISAEL3YHWEH

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.