The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 13

Every grade prints starting on a new page. No answers are included.

2 Chronicles 13 · Preschool

Trust God

Name Date

Color the trumpets. Judah trusted God, and God helped them.

Can you find these in the picture? Circle each one!

Bible Verse

“Thus the children of Israel were brought under at that time, and the children of Judah prevailed, because they relied on Yahweh, the God of their fathers.”

2 Chronicles 13:18 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Judah trusted God. God helped them. We can trust God when we are afraid.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Kindergarten

Trust

Name Date

Trace the Words

Trace each word with your pencil.

TRUST
GOD
HELP
CRY
In the eighteenth year of King Jeroboam, Abijah began to reign over Judah.

2 Chronicles 13:1 (WEB)

Match the Pictures

Draw a line from each word to its picture.

HORN
KING
LAMP
MOUNTAIN

Mini Maze

Help find the way through the maze.

Draw It

Draw trumpets.

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • When do you feel afraid?
  • Who can help you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Grade 1

God Is with Us

Name Date

Trace the Words

Trace the words and the verse.

TRUST
CRY
HORNS
HELP
In the eighteenth year of King Jeroboam, Abijah began to reign over Judah.

2 Chronicles 13:1 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Abijah stood on a mountain.
Judah kept God's lamps lit.
They cried to God.
The priests blew horns.
God helped them.

God Is with Us

Write the number 1 to 4 in each circle to show the right order.

We have priests serving Yahweh, the sons of Aaron, and the Levites in their work

Haven’t you driven out the priests of Yahweh

Behold, God is with us at our head

Now you intend to withstand the kingdom of Yahweh in the hand of the sons of David

Draw trumpets.

Memory Verse

“In the eighteenth year of King Jeroboam, Abijah began to reign over Judah.”

2 Chronicles 13:1 (WEB)

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where did Abijah stand?
  • What did the priests blow?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Grade 2

They Trusted God

Name Date

Read the Story

Abijah was king of Judah. A bigger army came against him. Abijah stood on a mountain.

He said, God is with us! He said Judah kept God's ways. He said they lit God's lamps. Do not fight against God.

Judah was in trouble. They cried out to God. The priests blew horns. God helped Judah because they trusted Him.

Memory Verse

“Thus the children of Israel were brought under at that time, and the children of Judah prevailed, because they relied on Yahweh, the God of their fathers.”

2 Chronicles 13:18 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who was king of Judah?

    AbijahThey cried out to GodOn a mountain

  2. Where did Abijah stand?

    They trusted HimAbijahOn a mountain

  3. What did Abijah say?

    God is with us!On a mountainAbijah

  4. What did Judah do when they were in trouble?

  5. Why did God help Judah?

    AbijahThey trusted HimOn a mountain

Word Search

Find and circle each word. Words go across and down.

FTDAVIDHRAPRIESTSIBJUDAHMYFIGACHOSENJEROBOAMLANYAHWEHYHISRAELFNCYTTRDHPLUHJSSNUML
  • JEROBOAM
  • PRIESTS
  • YAHWEH
  • ABIJAH
  • ISRAEL
  • CHOSEN
  • JUDAH
  • DAVID

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you speak up for God kindly?
  • What can you do when trouble feels all around you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Grade 3

Relying on Yahweh

Name Date

Read the Story

Abijah began to reign over Judah. Jeroboam came against him with an army twice as big. Abijah stood on Mount Zemaraim and spoke to Israel.

He said Yahweh gave the kingdom to David and his sons forever. Israel had golden calves and false priests. But Judah kept Yahweh's priests. They lit the gold lamp every evening. He said God was with them.

Jeroboam's men came behind Judah. Judah needed help. Judah cried to Yahweh, and the priests sounded the trumpets. Judah shouted, and God gave them the victory, because they relied on Yahweh.

Memory Verse

“Thus the children of Israel were brought under at that time, and the children of Judah prevailed, because they relied on Yahweh, the God of their fathers.”

2 Chronicles 13:18 (WEB)

Answer the Questions

  1. How big was Jeroboam's army?

  2. Where did Abijah stand?

  3. What did Israel have instead of God?

  4. What did Judah light every evening?

  5. Why did God give Judah the victory?

God Is with Us

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

DISRAELDTAADDULYKGSBVWUSACPJNIICYHHRULHJDAWOIDJKWACESEANTWEHHESHVWUWBHNTJEROBOAMS
  • JEROBOAM
  • PRIESTS
  • YAHWEH
  • ABIJAH
  • ISRAEL
  • CHOSEN
  • JUDAH
  • DAVID

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God?
  • Why is it good to pray when you are scared?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Grade 4

Do Not Fight Against God

Name Date

Read and Think

Abijah was Rehoboam's son. He had four hundred thousand men. Jeroboam had eight hundred thousand. Before the battle, Abijah stood on a mountain and called out to Israel. Yahweh had given the kingdom to David's family forever by a covenant of salt.

Abijah said that Jeroboam had rebelled, driven out Yahweh's priests, and made golden calves for gods. But Judah had not forsaken Yahweh. Their priests offered incense and burnt offerings, set out the show bread, and lit the lampstand. He said God was with them at their head, and he warned Israel not to fight against Yahweh.

Jeroboam set a trap, and the battle was before and behind them. They cried to Yahweh. The priests blew the trumpets, and the men of Judah shouted. God struck Jeroboam's army before Abijah. The men of Judah prevailed because they relied on Yahweh, the God of their fathers.

Show What You Know

  1. How many men did each side have?

  2. By what kind of covenant was the kingdom given to David?

  3. What had Jeroboam made for gods?

  4. What did Judah do when surrounded?

  5. Why did Judah prevail?

Word Bank Fill-In

Use the word bank to fill in each blank.

priestsIsraelJeroboamAbijahYahweh
  1. had eight hundred thousand.
  2. Before the battle, stood on a mountain and called out to Israel.
  3. But Judah had not forsaken .
  4. Their offered incense and burnt offerings, set out the show bread, and lit the lampstand.
  5. He said God was with them at their head, and he warned not to fight against Yahweh.

Think About It

  1. Judah was outnumbered two to one. When have you felt outnumbered, and how can you rely on God?

  2. Abijah pointed to faithful worship as Judah's strength. How does worship keep you close to God?

Memory Verse

Behold, God is with us at our head, and his priests with the trumpets of alarm to sound an alarm against you. Children of Israel, don’t fight against Yahweh, the God of your fathers; for you will not prosper.”

2 Chronicles 13:12 (WEB)

Copy It

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Israel worship instead of God?
  • How can you rely on God when outnumbered?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

2 Chronicles 13 · Grade 5

Outnumbered but Not Alone

Name Date

Read and Think

Abijah reigned only three years, but the Chronicler records one great moment. Facing an army twice his size, he stood on a mountain and preached. The kingdom belonged to David's line by a covenant of salt, a covenant meant to last. Jeroboam's rebellion was not just against Judah, but against Yahweh's kingdom.

Abijah contrasted two ways of worship. Israel had golden calves and priests anyone could become by bringing an offering. Judah kept the priests of Aaron, the morning and evening offerings, the show bread, and the lamps. Then he warned the children of Israel not to fight against Yahweh, for they would not prosper.

When the ambush closed around them, Judah cried to Yahweh, and God delivered them. The key line explains why: they relied on Yahweh, the God of their fathers. Jeroboam never recovered strength, while Abijah grew mighty. In the New Testament, Paul asks, if God is for us, who can be against us? (Romans 8:31).

Show What You Know

  1. How long did Abijah reign?

  2. What did a covenant of salt mean?

  3. How could anyone become a priest in Israel?

  4. What explains Judah's victory?

  5. What does Paul ask in Romans 8:31?

Crossword

4213

Across

  1. In the eighteenth year of King ____

Down

  1. Gave the kingdom over ____ to David forever
  2. ____ stood up on Mount Zemaraim
  3. Ought you not to know that ____
  4. Abijah began to reign over ____

Think About It

  1. In the New Testament, Paul asks, if God is for us, who can be against us? (Romans 8:31). How does that help when you feel alone?

  2. Abijah warned Israel not to fight against God. In what ways do people fight against God today?

Memory Verse

“Thus the children of Israel were brought under at that time, and the children of Judah prevailed, because they relied on Yahweh, the God of their fathers.”

2 Chronicles 13:18 (WEB)

Copy It

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does Romans 8:31 in the New Testament encourage you?
  • How do people fight against God today?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.