The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 13

Prints on letter paper in black and white. No answers are printed on the student sheet.

2 Chronicles 13 · Grade 2

They Trusted God

Name Date

Read the Story

Abijah was king of Judah. A bigger army came against him. Abijah stood on a mountain.

He said, God is with us! He said Judah kept God's ways. He said they lit God's lamps. Do not fight against God.

Judah was in trouble. They cried out to God. The priests blew horns. God helped Judah because they trusted Him.

Memory Verse

“Thus the children of Israel were brought under at that time, and the children of Judah prevailed, because they relied on Yahweh, the God of their fathers.”

2 Chronicles 13:18 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who was king of Judah?

    AbijahThey cried out to GodOn a mountain

  2. Where did Abijah stand?

    They trusted HimAbijahOn a mountain

  3. What did Abijah say?

    God is with us!On a mountainAbijah

  4. What did Judah do when they were in trouble?

  5. Why did God help Judah?

    AbijahThey trusted HimOn a mountain

Word Search

Find and circle each word. Words go across and down.

FTDAVIDHRAPRIESTSIBJUDAHMYFIGACHOSENJEROBOAMLANYAHWEHYHISRAELFNCYTTRDHPLUHJSSNUML
  • JEROBOAM
  • PRIESTS
  • YAHWEH
  • ABIJAH
  • ISRAEL
  • CHOSEN
  • JUDAH
  • DAVID

Prayer

Dear God, thank You for being with us. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you speak up for God kindly?
  • What can you do when trouble feels all around you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.