The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 27

For teachers and parents. Prints separately from the student sheets.

1 Samuel 27 · For teachers and parents

Answer Key: David Among the Philistines

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolZiklag

citypeoplehousecamelsheep

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenA New Town

TOWN → picture 4MEN → picture 3HOME → picture 1KING → picture 2

Grade 1David Moves Away

David was afraid of Saul. → picture 5Six hundred men went with him. → picture 1He went to King Achish. → picture 4He lived in a town called Ziklag. → picture 2He stayed there more than a year. → picture 3

Order:

1. David thinks Saul will catch him2. David goes to Achish3. Achish gives David Ziklag4. Achish believes David

Grade 2Living Far Away

  1. Why did David leave Israel? He thought Saul would get him one day.
  2. How many men went with David? Six hundred (circle)
  3. Who was the king of Gath? Achish (circle)
  4. What town did the king give David? Ziklag (circle)
  5. How long did David live there? One year and four months
MEKCAMELSOMWYEARGSNAVZIKLAGTAPSDGSIGHECEHAEEASPEHWEVNTSMOAITEIHSBCKKSFPDNNSEDUHVF

Grade 3A Year in Ziklag

  1. What did David say in his heart? He would perish one day by the hand of Saul.
  2. Why did Saul stop looking for David? He was told David had fled to Gath.
  3. How long did David live among the Philistines? A full year and four months
  4. Which peoples did David raid? The Geshurites, the Girzites, and the Amalekites
  5. What did Achish think about David? He would be his servant forever.
1: David thinks Saul will catch him2: David goes to Achish3: Achish gives David Ziklag4: Achish believes David

Grade 4A Season of Compromise

  1. Who did David speak to at the start of the chapter? Himself
  2. What is missing compared to earlier chapters? Any mention of David inquiring of Yahweh
  3. What kind of life did David live? A double life
  4. What does the chapter show about fear? It can lead even a faithful person into deception.

Word bank: 1. David; 2. Ziklag; 3. Achish; 4. Gath

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Speaking in His Heart

  1. What kind of man speaks in 27:1? A weary man reasoning alone
  2. What does the narrator not record? Any inquiry of Yahweh
  3. Why did David leave no one alive? So that no one could report to Achish what he had done
  4. What did Achish conclude? David would be his servant forever.
4ZIKLAG2ACHSH5MONTS3HERT1GTH

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.