The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 27

Every grade prints starting on a new page. No answers are included.

1 Samuel 27 · Preschool

Ziklag

Name Date

Color the little town of Ziklag where David lived!

Can you find these in the picture? Circle each one!

Bible Verse

“Then Achish gave him Ziklag that day: therefore Ziklag belongs to the kings of Judah to this day.”

1 Samuel 27:6 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: David was tired of running from Saul. He moved to a town called Ziklag. Even when we are tired and scared, God is still with us.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Kindergarten

A New Town

Name Date

Trace the Words

Trace each word with your pencil.

GATH
TOWN
YEAR
MEN
Saul was told that David had fled to Gath, so he stopped looking for him.

1 Samuel 27:4 (WEB)

Match the Pictures

Draw a line from each word to its picture.

TOWN
MEN
HOME
KING

Mini Maze

Help find the way through the maze.

Draw It

Draw a place where you feel at home.

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where did David go to live?
  • What can you do when you feel tired and scared?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Grade 1

David Moves Away

Name Date

Trace the Words

Trace the words and the verse.

GATH
SAUL
TOWN
YEAR
Saul was told that David had fled to Gath, so he stopped looking for him.

1 Samuel 27:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

David was afraid of Saul.
Six hundred men went with him.
He went to King Achish.
He lived in a town called Ziklag.
He stayed there more than a year.

David Among the Philistines

Write the number 1 to 4 in each circle to show the right order.

Achish gives David Ziklag

David thinks Saul will catch him

Achish believes David

David goes to Achish

Draw a place where you feel at home.

Memory Verse

“Saul was told that David had fled to Gath, so he stopped looking for him.”

1 Samuel 27:4 (WEB)

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did David move to the land of the Philistines?
  • What town did Achish give David?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Grade 2

Living Far Away

Name Date

Read the Story

David was tired of running from Saul. He thought Saul would get him one day. So David went to the land of the Philistines. Six hundred men went with him.

David went to Achish, the king of Gath. Saul heard that David was in Gath. So Saul stopped looking for him.

The king gave David a town named Ziklag. David lived there one year and four months. David fought Israel's enemies. But he did not tell King Achish the truth about it.

Memory Verse

“Saul was told that David had fled to Gath, so he stopped looking for him.”

1 Samuel 27:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Why did David leave Israel?

  2. How many men went with David?

    ZiklagAchishSix hundred

  3. Who was the king of Gath?

    AchishOne year and four monthsSix hundred

  4. What town did the king give David?

    One year and four monthsZiklagAchish

  5. How long did David live there?

Word Search

Find and circle each word. Words go across and down.

MEKCAMELSOMWYEARGSNAVZIKLAGTAPSDGSIGHECEHAEEASPEHWEVNTSMOAITEIHSBCKKSFPDNNSEDUHVF
  • ZIKLAG
  • ACHISH
  • MONTHS
  • CAMELS
  • DAVID
  • SHEEP
  • GATH
  • YEAR

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did Saul stop looking for David?
  • Who did David fight while he lived in Ziklag?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Grade 3

A Year in Ziklag

Name Date

Read the Story

David said in his heart that he would perish one day by the hand of Saul. He chose to escape to the land of the Philistines. He went with six hundred men and their households to Achish, king of Gath.

Saul was told that David had fled to Gath, so he stopped looking for him. David asked Achish for a place in a country town. Achish gave him Ziklag that day. David lived in the country of the Philistines a full year and four months.

David and his men raided the Geshurites, the Girzites, and the Amalekites. These were old enemies of Israel. But when Achish asked where he had raided, David named places in the South of Judah. He did not tell the truth. Achish believed David. He thought David would be his servant forever.

Memory Verse

David said in his heart, “I will now perish one day by the hand of Saul. There is nothing better for me than that I should escape into the land of the Philistines; and Saul will despair of me, to seek me any more in all the borders of Israel. So I will escape out of his hand.”

1 Samuel 27:1 (WEB)

Answer the Questions

  1. What did David say in his heart?

  2. Why did Saul stop looking for David?

  3. How long did David live among the Philistines?

  4. Which peoples did David raid?

  5. What did Achish think about David?

David Among the Philistines

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is it wrong to trick people even if they are not our friends?
  • What can you do when you feel tired of waiting on God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Grade 4

A Season of Compromise

Name Date

Read and Think

Chapter 27 begins with David speaking to himself, not to God. He said in his heart, I will now perish one day by the hand of Saul. Unlike earlier chapters, there is no mention of David inquiring of Yahweh. Fear drove him into the land of Israel's enemies.

The plan worked on the surface. Saul stopped hunting him, and Achish gave him Ziklag. David's men and their families had a home. Yet David lived a double life. He raided the Geshurites, Girzites, and Amalekites, ancient enemies of Israel.

When Achish asked about the raids, David said he had attacked the South of Judah. To keep his secret, David saved neither man nor woman alive to bring to Gath, so that no one could tell Achish what he had done. Achish believed David and thought David's own people would hate him. The chapter shows how fear can lead even a faithful person into deception.

Show What You Know

  1. Who did David speak to at the start of the chapter?

  2. What is missing compared to earlier chapters?

  3. What kind of life did David live?

  4. What does the chapter show about fear?

Word Bank Fill-In

Use the word bank to fill in each blank.

GathZiklagAchishDavid
  1. Chapter 27 begins with speaking to himself, not to God.
  2. Saul stopped hunting him, and Achish gave him .
  3. When asked about the raids, David said he had attacked the South of Judah.
  4. To keep his secret, David saved neither man nor woman alive to bring to , so that no one could tell Achish what he had done.

Think About It

  1. What happens when we make plans out of fear instead of asking God?

  2. Why does the Bible tell us about David's deception?

Memory Verse

David said in his heart, “I will now perish one day by the hand of Saul. There is nothing better for me than that I should escape into the land of the Philistines; and Saul will despair of me, to seek me any more in all the borders of Israel. So I will escape out of his hand.”

1 Samuel 27:1 (WEB)

Copy It

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can a friend help you when you feel like giving up?
  • How can fear lead us to make poor choices?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Samuel 27 · Grade 5

Speaking in His Heart

Name Date

Read and Think

After the high point of chapter 26, chapter 27 marks a turn. David said in his heart, I will now perish one day by the hand of Saul. These are the words of a weary man reasoning alone. Despite God's promises and Jonathan's assurance, David concluded that there was nothing better for him than to escape into the land of the Philistines. Notably, the narrator records no inquiry of Yahweh.

Outwardly, the move succeeded. Saul stopped looking for him. Achish granted him Ziklag, which, the narrator notes, belongs to the kings of Judah to this day. For a year and four months David's band and their households lived among the Philistines.

But safety came at a moral price. David raided the Geshurites, Girzites, and Amalekites, and he left no one alive, so that no one could report to Achish what he had done. He then told Achish he had raided the South of Judah. Achish concluded that David had made his people Israel utterly abhor him and would be his servant forever. The anointed future king was living a lie in enemy territory, and the next chapters will show the danger of this compromise.

Show What You Know

  1. What kind of man speaks in 27:1?

  2. What does the narrator not record?

  3. Why did David leave no one alive?

  4. What did Achish conclude?

Crossword

42531

Across

  1. The city where Achish was king (27:2)
  2. The town Achish gave David (27:6)
  3. David lived there a full year and four ____ (27:7).

Down

  1. The king who believed David (27:12)
  2. David said in his ____, I will now perish (27:1).

Think About It

  1. How can weariness lead us to forget God's promises?

  2. What compromises might seem to make life easier but cost us our integrity?

Memory Verse

David said in his heart, “I will now perish one day by the hand of Saul. There is nothing better for me than that I should escape into the land of the Philistines; and Saul will despair of me, to seek me any more in all the borders of Israel. So I will escape out of his hand.”

1 Samuel 27:1 (WEB)

Copy It

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • When you fail, how can you remember that God stays faithful?
  • Where can you find strength when you feel worn out?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.