The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 27

Prints on letter paper in black and white. No answers are printed on the student sheet.

1 Samuel 27 · Grade 2

Living Far Away

Name Date

Read the Story

David was tired of running from Saul. He thought Saul would get him one day. So David went to the land of the Philistines. Six hundred men went with him.

David went to Achish, the king of Gath. Saul heard that David was in Gath. So Saul stopped looking for him.

The king gave David a town named Ziklag. David lived there one year and four months. David fought Israel's enemies. But he did not tell King Achish the truth about it.

Memory Verse

“Saul was told that David had fled to Gath, so he stopped looking for him.”

1 Samuel 27:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Why did David leave Israel?

  2. How many men went with David?

    ZiklagAchishSix hundred

  3. Who was the king of Gath?

    AchishOne year and four monthsSix hundred

  4. What town did the king give David?

    One year and four monthsZiklagAchish

  5. How long did David live there?

Word Search

Find and circle each word. Words go across and down.

MEKCAMELSOMWYEARGSNAVZIKLAGTAPSDGSIGHECEHAEEASPEHWEVNTSMOAITEIHSBCKKSFPDNNSEDUHVF
  • ZIKLAG
  • ACHISH
  • MONTHS
  • CAMELS
  • DAVID
  • SHEEP
  • GATH
  • YEAR

Prayer

Dear God, thank You for being with me wherever I go. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did Saul stop looking for David?
  • Who did David fight while he lived in Ziklag?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.