The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 25

Prints on letter paper in black and white. No answers are printed on the student sheet.

1 Samuel 25 · Grade 2

A Wise Woman

Name Date

Read the Story

Samuel died. All Israel was sad. A rich man named Nabal had many sheep. David's men had kept Nabal's shepherds safe. David asked Nabal for some food.

Nabal was rude. He said no. David was very angry. He wanted to get back at Nabal. He set out with four hundred men.

Nabal's wife Abigail was wise. She brought bread and other food on donkeys. She bowed to David and asked him not to get back at Nabal. David thanked God for sending her. Later Nabal died, and Abigail became David's wife.

Memory Verse

David said to Abigail, “Blessed is Yahweh, the God of Israel, who sent you today to meet me!

1 Samuel 25:32 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who died at the start of the chapter?

    SamuelBread and other foodDavid's men

  2. Who kept Nabal's shepherds safe?

    Bread and other foodDavid's menSamuel

  3. How did Nabal answer David?

  4. What did Abigail bring?

    SamuelBread and other foodHe was rude and said no

  5. Who did David thank for sending Abigail?

    SamuelDavid's menGod

Word Search

Find and circle each word. Words go across and down.

DAUYIHVPVOBBPFLSEENBSIBBAASKAOCGROCPENBWAAEEKYDFANRIASMTNWLNMLDSMSHEEPEWSVCVWIFEL
  • ABIGAIL
  • DONKEY
  • CARMEL
  • NABAL
  • BREAD
  • SHEEP
  • PEACE
  • WIFE

Prayer

Dear God, thank You for wise words. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why was David so angry?
  • Who told Abigail what had happened?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.