The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 25

For teachers and parents. Prints separately from the student sheets.

1 Samuel 25 · For teachers and parents

Answer Key: Abigail's Wise Words

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolWise Abigail

donkeybreadsheepWomanperson

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenWise Words

DONKEY → picture 3BREAD → picture 1ABIGAIL → picture 4SHEEP → picture 2

Grade 1Abigail Helps David

Nabal had many sheep. → picture 4Nabal was rude to David's men. → picture 3Abigail brought bread. → picture 1She rode on a donkey. → picture 5David thanked God for her. → picture 2

Order:

1. Samuel dies2. Nabal insults David's men3. Abigail rides to meet David4. David blesses Yahweh for sending her

Grade 2A Wise Woman

  1. Who died at the start of the chapter? Samuel (circle)
  2. Who kept Nabal's shepherds safe? David's men (circle)
  3. How did Nabal answer David? He was rude and said no.
  4. What did Abigail bring? Bread and other food (circle)
  5. Who did David thank for sending Abigail? God (circle)
DAUYIHVPVOBBPFLSEENBSIBBAASKAOCGROCPENBWAAEEKYDFANRIASMTNWLNMLDSMSHEEPEWSVCVWIFEL

Grade 3Kept From Revenge

  1. What was Abigail like? Intelligent
  2. What had David's men been to Nabal's shepherds? A wall by night and by day
  3. What did Nabal say? Who is David?
  4. How many loaves did Abigail bring? Two hundred
  5. What happened to Nabal about ten days later? Yahweh struck him, so that he died.
1: Samuel dies2: Nabal insults David's men3: Abigail rides to meet David4: David blesses Yahweh for sending her

Grade 4A Peacemaker

  1. What did Abigail say was with Nabal? Folly
  2. What was David about to do? Take vengeance with his own hand
  3. What did Abigail remind David? That the Lord would make him a sure house
  4. What did David bless? Abigail's discretion

Word bank: 1. Abigail; 2. God; 3. Nabal

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Blessed Is Your Discretion

  1. What does Nabal's response to David show? Contempt
  2. What contrast does the chapter draw? Restraint toward Saul, rage toward Nabal
  3. To what does Abigail appeal? David's future as prince over Israel
  4. Who dealt with Nabal? Yahweh
5DONKEY3PEAC4CARML1NABL2ABIGIL

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.