The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 3

For teachers and parents. Prints separately from the student sheets.

1 Kings 3 · For teachers and parents

Answer Key: Solomon Asks for Wisdom

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolSolomon's Prayer

crownpersonbabyhearthouse

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenA Wise Heart

KING → picture 4HEART → picture 3NIGHT → picture 1BABY → picture 2

Grade 1Ask God for Wisdom

God came to Solomon at night. → picture 5Solomon had a dream. → picture 1He asked for a wise heart. → picture 4God gave him riches too. → picture 2He helped a mother. → picture 3

Order:

1. Yahweh appeared to Solomon in a dream by night2. Give your servant therefore an understanding heart to judge your people3. I have given you a wise and understanding heart4. All Israel heard of the judgment which the king had judged

Grade 2Solomon Asks God

  1. When did God come to Solomon? At night in a dream
  2. What did Solomon ask for? A heart to know good from bad
  3. How did God feel? Glad (circle)
  4. What else did God give him? Riches and honor (circle)
  5. Who got the baby? The real mother (circle)
BSFICFNVNWRICHESYDIGEKIMLLRWIEWLOHNEJBDYDTCDAUERUVHYHMDOGWHEARTGNMSGROBYEGWISDOMS

Grade 3An Understanding Heart

  1. Where did God appear to Solomon? In Gibeon in a dream
  2. What did Solomon say he was like? A little child
  3. What did Solomon ask God for? An understanding heart to judge His people
  4. What else did God give Solomon? Riches and honor
  5. What did all Israel see? God's wisdom was in him.
1: Yahweh appeared to Solomon in a dream by night2: Give your servant therefore an understanding heart to judge your people3: I have given you a wise and understanding heart4: All Israel heard of the judgment which the king had judged

Grade 4Wisdom from God

  1. How many burnt offerings did Solomon offer at Gibeon? A thousand
  2. What did God give Solomon that he had not asked for? Riches and honor
  3. What did the real mother cry out? To give the baby to the other woman so he would live
  4. Why did all Israel fear the king? They saw the wisdom of God in him.

Word bank: 1. Gibeon; 2. dream; 3. child; 4. riches; 5. heart

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5An Understanding Heart

  1. Why did Solomon sacrifice at the high places? The temple was not yet built.
  2. What three things did Solomon do in his prayer? He praised God's faithfulness to David, admitted that he was like a little child, and asked for an understanding heart.
  3. What moved the true mother to give up her claim? Her love, so her son would live
  4. What does James say about wisdom? Anyone who lacks wisdom should ask God, who gives to all liberally.
5JUDGE4MOTHR3DREA2HEAT1CILD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.