The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 3

Every grade prints starting on a new page. No answers are included.

1 Kings 3 · Preschool

Solomon's Prayer

Name Date

Color the crown, the moon, and the stars. Solomon asked God for a wise heart.

Can you find these in the picture? Circle each one!

Bible Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Solomon asked God to help him know right from wrong. We can ask God for wisdom too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Kindergarten

A Wise Heart

Name Date

Trace the Words

Trace each word with your pencil.

WISE
HEART
ASK
DREAM
In Gibeon, Yahweh appeared to Solomon in a dream by night; and God said, “Ask for what I should give you.”

1 Kings 3:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

KING
HEART
NIGHT
BABY

Mini Maze

Help find the way through the maze.

Draw It

Draw yourself asking God for wisdom.

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Solomon ask God for?
  • How did Solomon help the mother?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Grade 1

Ask God for Wisdom

Name Date

Trace the Words

Trace the words and the verse.

WISE
HEART
ASK
GOD
In Gibeon, Yahweh appeared to Solomon in a dream by night; and God said, “Ask for what I should give you.”

1 Kings 3:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God came to Solomon at night.
Solomon had a dream.
He asked for a wise heart.
God gave him riches too.
He helped a mother.

A Wise Heart

Write the number 1 to 4 in each circle to show the right order.

All Israel heard of the judgment which the king had judged

I have given you a wise and understanding heart

Yahweh appeared to Solomon in a dream by night

Give your servant therefore an understanding heart to judge your people

Draw yourself asking God for wisdom.

Memory Verse

In Gibeon, Yahweh appeared to Solomon in a dream by night; and God said, “Ask for what I should give you.”

1 Kings 3:5 (WEB)

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do you want to be good at?
  • What can you ask God for today?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Grade 2

Solomon Asks God

Name Date

Read the Story

God came to Solomon in a dream at night. God said, Ask for what I should give you.

Solomon said he was like a little child. He did not know how to lead. He asked for a heart to know good from bad. God was glad. God gave him a wise heart. God gave him riches and honor too.

Two women came to the king. Each said a baby was hers. Solomon gave them a test. The test showed the real mother. She got her baby. The people saw that God made Solomon wise.

Memory Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. When did God come to Solomon?

  2. What did Solomon ask for?

  3. How did God feel?

    At night in a dreamRiches and honorGlad

  4. What else did God give him?

    The real motherGladRiches and honor

  5. Who got the baby?

    At night in a dreamRiches and honorThe real mother

Word Search

Find and circle each word. Words go across and down.

BSFICFNVNWRICHESYDIGEKIMLLRWIEWLOHNEJBDYDTCDAUERUVHYHMDOGWHEARTGNMSGROBYEGWISDOMS
  • WISDOM
  • MOTHER
  • RICHES
  • GIBEON
  • DREAM
  • HEART
  • JUDGE
  • CHILD

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who came to Solomon at night?
  • How can you learn what is right?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Grade 3

An Understanding Heart

Name Date

Read the Story

Solomon loved God and went to Gibeon to worship. That night God appeared to him in a dream. God said, Ask for what I should give you. Solomon said that he was like a little child and did not know how to go out or come in.

Solomon asked God for an understanding heart to judge His people and to tell good from evil. God was pleased that Solomon had not asked for long life or riches. God gave him a wise heart, and also riches and honor. If Solomon walked in God's ways, God would give him long life too.

Later two women came to the king. Both lived in one house, and each had a baby. One baby died in the night. Each woman said the living baby was hers. Solomon gave a wise test, and the true mother showed her love. Solomon gave her the baby. All Israel saw that God's wisdom was in him.

Memory Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Answer the Questions

  1. Where did God appear to Solomon?

  2. What did Solomon say he was like?

  3. What did Solomon ask God for?

  4. What else did God give Solomon?

  5. What did all Israel see?

A Wise Heart

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did God feel about Solomon's prayer?
  • When do you need a wise heart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Grade 4

Wisdom from God

Name Date

Read and Think

Early in his reign, Solomon loved the Lord and walked in the statutes of David his father. He went to Gibeon, the great high place, and offered a thousand burnt offerings. That night God appeared to him in a dream and said, Ask for what I should give you. Solomon remembered God's great loving kindness to David.

Solomon called himself a little child among a great people. He asked for an understanding heart to judge God's people and discern between good and evil. God was pleased because Solomon had not asked for long life, riches, or the life of his enemies. God gave him a wise and understanding heart, and also riches and honor that he had not asked for.

Soon a hard case tested this gift. Two women lived in one house, and each had a baby boy. One baby died in the night. Each woman claimed the living child. Solomon called for a sword and ordered the child to be divided. The real mother cried out to give the baby to the other woman so he would live. Solomon knew she was the mother, and the child was safe. All Israel feared the king, for they saw the wisdom of God in him.

Show What You Know

  1. How many burnt offerings did Solomon offer at Gibeon?

  2. What did God give Solomon that he had not asked for?

  3. What did the real mother cry out?

  4. Why did all Israel fear the king?

Word Bank Fill-In

Use the word bank to fill in each blank.

heartchildGibeonrichesdream
  1. He went to , the great high place, and offered a thousand burnt offerings.
  2. That night God appeared to him in a and said, Ask for what I should give you.
  3. Solomon called himself a little among a great people.
  4. God was pleased because Solomon had not asked for long life, , or the life of his enemies.
  5. God gave him a wise and understanding , and also riches and honor that he had not asked for.

Think About It

  1. Solomon asked for wisdom to serve others, not for riches. What would you ask God for to help other people?

  2. When do you need wisdom from God to know what is right?

Memory Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Copy It

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • What decision in your life right now needs God's wisdom?
  • How can you grow in being wise and not just smart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Kings 3 · Grade 5

An Understanding Heart

Name Date

Read and Think

Solomon's reign began with love for God. He walked in David's statutes, though he still sacrificed at the high places, since the temple was not yet built. At Gibeon, after a thousand burnt offerings, God appeared to him in a dream with an open offer: Ask for what I should give you.

Solomon's answer is a model of humble prayer. He praised God's faithfulness to David, admitted that he was like a little child, and asked for an understanding heart to judge God's people. The request pleased the Lord. God gave him a wise and understanding heart, so that no one before or after would be like him. God also gave riches and honor, and promised long life if Solomon would walk in His ways.

The case of the two mothers shows this wisdom at work. With no witnesses, it was one woman's word against another. Solomon called for a sword and gave an order that would show what was in each heart. The true mother's love moved her to give up her claim so her son would live. Solomon gave her the child, who was never harmed. Israel saw that the wisdom of God was in him to do justice. In the New Testament, James says that anyone who lacks wisdom should ask God, who gives to all liberally (James 1:5).

Show What You Know

  1. Why did Solomon sacrifice at the high places?

  2. What three things did Solomon do in his prayer?

  3. What moved the true mother to give up her claim?

  4. What does James say about wisdom?

Crossword

54321

Across

  1. And laid her dead ____ in my bosom.
  2. Yahweh appeared to Solomon in a ____ by night.
  3. Give your servant therefore an understanding heart to ____ your people.

Down

  1. And in uprightness of ____ with you.
  2. She is his ____.

Think About It

  1. James says God gives wisdom liberally. What decision can you pray about this week?

  2. Solomon saw himself as a little child before God. How does humility help you learn?

Memory Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Copy It

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • If God asked what you wanted, what would you ask for?
  • How can humility help you pray?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.