The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 3

Prints on letter paper in black and white. No answers are printed on the student sheet.

1 Kings 3 · Grade 2

Solomon Asks God

Name Date

Read the Story

God came to Solomon in a dream at night. God said, Ask for what I should give you.

Solomon said he was like a little child. He did not know how to lead. He asked for a heart to know good from bad. God was glad. God gave him a wise heart. God gave him riches and honor too.

Two women came to the king. Each said a baby was hers. Solomon gave them a test. The test showed the real mother. She got her baby. The people saw that God made Solomon wise.

Memory Verse

Give your servant therefore an understanding heart to judge your people, that I may discern between good and evil; for who is able to judge this great people of yours?”

1 Kings 3:9 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. When did God come to Solomon?

  2. What did Solomon ask for?

  3. How did God feel?

    At night in a dreamRiches and honorGlad

  4. What else did God give him?

    The real motherGladRiches and honor

  5. Who got the baby?

    At night in a dreamRiches and honorThe real mother

Word Search

Find and circle each word. Words go across and down.

BSFICFNVNWRICHESYDIGEKIMLLRWIEWLOHNEJBDYDTCDAUERUVHYHMDOGWHEARTGNMSGROBYEGWISDOMS
  • WISDOM
  • MOTHER
  • RICHES
  • GIBEON
  • DREAM
  • HEART
  • JUDGE
  • CHILD

Prayer

Dear God, thank You for giving wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who came to Solomon at night?
  • How can you learn what is right?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.