The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 5

For teachers and parents. Prints separately from the student sheets.

1 Corinthians 5 · For teachers and parents

Answer Key: A Little Yeast

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolClean and New

Breadsunheartpeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenFresh Bread

BREAD → picture 3CLEAN → picture 1NEW → picture 4TRUE → picture 2

Grade 1A Little Yeast

Yeast spreads in dough. → picture 4Sin spreads too. → picture 3Jesus makes people clean. → picture 1God's people are new. → picture 5Live in truth. → picture 2

Grade 2A Little Yeast

  1. What does yeast do in dough? It spreads (circle)
  2. What is sin like? Yeast (circle)
  3. How should the church have felt? Sad (circle)
  4. What did Jesus make His people? Clean and new (circle)
  5. How does God want His people to live? In truth (circle)
WODIYYFLKPUANEBSVADTRSAFPKRLSMTSWIURUINETORUOMDKAWRIPGPENDFLTSARPIKRDTKNMREMOVEDT

Grade 3Christ Our Passover

  1. What does a little yeast do? It leavens the whole lump
  2. What should the church have felt about the sin? Sad
  3. What did families clean out at Passover? The old yeast
  4. Who is like the Passover lamb? Christ
1: Purge out the old yeast, that you may be a new lump, even as you are unleavened2: Therefore let’s keep the feast, not with old yeast, neither with the yeast of malice and wickedness, but with the unleavened bread of sincerity and truth3: Don’t you judge those who are within4: But those who are outside, God judges
MJSKPUBREAGIPWNBRGRRONIOAAEHERUSRRIHYTMOTTILOLEPOGSETDBUANVAIARARMSVENDDGCVPTLDTE

Grade 4Clean Out the Old Yeast

  1. Why should the church have mourned? Sin in a church family is a reason for sorrow
  2. What did Jewish families remove at Passover? Every bit of old yeast
  3. Who was sacrificed in our place? Christ, our Passover
  4. Who judges those outside the church? God

Word bank: 1. arrogant; 2. yeast; 3. removed; 4. lump; 5. outside

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Sincerity and Truth

  1. What was Paul's goal in disciplining the man? Rescue, that his spirit may be saved, and protection of the church
  2. Why did yeast become a picture of sin? It works quietly and spreads through the whole lump of dough
  3. What grounds Paul's command to purge the old yeast? Christ, our Passover, has been sacrificed in our place
  4. Does Paul tell believers to withdraw from unbelievers in the world? No, church discipline concerns those inside the fellowship
3YEAST2OUTSID1WRLD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.