The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Every grade prints starting on a new page. No answers are included.

1 Corinthians 5 · Preschool

Clean and New

Name Date

Color the fresh bread. Jesus makes us clean and new!

Can you find these in the picture? Circle each one!

Bible Verse

“Purge out the old yeast, that you may be a new lump, even as you are unleavened. For indeed Christ, our Passover, has been sacrificed in our place.”

1 Corinthians 5:7 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Show a piece of bread. Say: A little yeast spreads through all the dough. Jesus helps us make good choices that spread to others.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Kindergarten

Fresh Bread

Name Date

Trace the Words

Trace each word with your pencil.

BREAD
CLEAN
NEW
TRUE
Your boasting is not good. Don’t you know that a little yeast leavens the whole lump?

1 Corinthians 5:6 (WEB)

Match the Pictures

Draw a line from each word to its picture.

BREAD
CLEAN
NEW
TRUE

Mini Maze

Help find the way through the maze.

Draw It

Draw fresh bread for a new start.

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does yeast do to bread?
  • How can you make a good choice today?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Grade 1

A Little Yeast

Name Date

Trace the Words

Trace the words and the verse.

YEAST
DOUGH
CLEAN
JESUS
TRUTH
Your boasting is not good. Don’t you know that a little yeast leavens the whole lump?

1 Corinthians 5:6 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Yeast spreads in dough.
Sin spreads too.
Jesus makes people clean.
God's people are new.
Live in truth.

Draw fresh bread for a new start.

Memory Verse

“Your boasting is not good. Don’t you know that a little yeast leavens the whole lump?”

1 Corinthians 5:6 (WEB)

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is sin like?
  • Who makes us clean and new?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Grade 2

A Little Yeast

Name Date

Read the Story

Bakers put a little yeast in dough. The yeast spreads. Soon all the dough puffs up.

Paul said sin is like yeast. A little sin can spread to many people. The church in Corinth had a sin they did not stop. They were proud. They should have been sad.

Jesus died to make His people clean and new. So Paul told them to clean out the old yeast. God wants His people to live in truth.

Memory Verse

“Your boasting is not good. Don’t you know that a little yeast leavens the whole lump?”

1 Corinthians 5:6 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does yeast do in dough?

    Clean and newIt spreadsIn truth

  2. What is sin like?

    YeastIt spreadsIn truth

  3. How should the church have felt?

    It spreadsSadIn truth

  4. What did Jesus make His people?

    In truthClean and newSad

  5. How does God want His people to live?

    In truthYeastIt spreads

Word Search

Find and circle each word. Words go across and down.

WODIYYFLKPUANEBSVADTRSAFPKRLSMTSWIURUINETORUOMDKAWRIPGPENDFLTSARPIKRDTKNMREMOVEDT
  • ARROGANT
  • OUTSIDE
  • INSTEAD
  • REMOVED
  • SPIRIT
  • YEAST
  • WORLD
  • LUMP

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you tell God you are sorry?
  • How can you help a friend do right?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Grade 3

Christ Our Passover

Name Date

Read the Story

Yeast is tiny, but it spreads through a whole lump of dough. Paul asked, Don't you know that a little yeast leavens the whole lump? He meant that sin is like yeast.

A member of the church in Corinth had done a serious wrong. The church did nothing about it. They were even proud. Paul wanted them to be sad about the sin and to lovingly correct it.

At Passover, Jewish families cleaned all the old yeast out of their homes. Paul said that Christ is like the Passover lamb. He was sacrificed for His people. So they should live with sincerity and truth.

Memory Verse

“Purge out the old yeast, that you may be a new lump, even as you are unleavened. For indeed Christ, our Passover, has been sacrificed in our place.”

1 Corinthians 5:7 (WEB)

Answer the Questions

  1. What does a little yeast do?

  2. What should the church have felt about the sin?

  3. What did families clean out at Passover?

  4. Who is like the Passover lamb?

A Little Yeast

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

MJSKPUBREAGIPWNBRGRRONIOAAEHERUSRRIHYTMOTTILOLEPOGSETDBUANVAIARARMSVENDDGCVPTLDTE
  • ARROGANT
  • OUTSIDE
  • INSTEAD
  • REMOVED
  • SPIRIT
  • YEAST
  • WORLD
  • LUMP

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • What wrong habit could you ask God to help you stop?
  • How can you thank Jesus for giving Himself for you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Grade 4

Clean Out the Old Yeast

Name Date

Read and Think

Paul had heard that a church member was living in serious sin, and the church was allowing it. Worse, the church was arrogant. Paul says they should have mourned. Sin in a church family is a reason for sorrow, not pride.

Paul uses a word picture. Just as a little yeast spreads through a whole lump of dough, one unchecked sin can affect the whole church. At Passover, Jewish families searched their houses and removed every bit of old yeast.

Christ, our Passover, has been sacrificed in our place. Because of Him, believers are a new lump. They should keep the feast with the unleavened bread of sincerity and truth. Paul explains that the church should correct its own members, but God judges those outside.

Show What You Know

  1. Why should the church have mourned?

  2. What did Jewish families remove at Passover?

  3. Who was sacrificed in our place?

  4. Who judges those outside the church?

Word Bank Fill-In

Use the word bank to fill in each blank.

arrogantlumpoutsideyeastremoved
  1. Worse, the church was .
  2. Just as a little spreads through a whole lump of dough, one unchecked sin can affect the whole church.
  3. At Passover, Jewish families searched their houses and every bit of old yeast.
  4. Because of Him, believers are a new .
  5. Paul explains that the church should correct its own members, but God judges those .

Think About It

  1. A little yeast spreads through the whole lump. How can a small wrong choice affect other people?

  2. Paul wanted the church to correct sin out of love. Why is it loving to help a friend turn away from what is wrong?

Memory Verse

“Therefore let’s keep the feast, not with old yeast, neither with the yeast of malice and wickedness, but with the unleavened bread of sincerity and truth.”

1 Corinthians 5:8 (WEB)

Copy It

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can one wrong choice affect others?
  • Why is loving correction important?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 5 · Grade 5

Sincerity and Truth

Name Date

Read and Think

The Corinthian church had tolerated a serious sin in one of its members, one that even the surrounding culture found shocking. Instead of grieving and acting, the church remained puffed up. Paul directs them to remove the man from their fellowship. His goal is not cruelty but rescue, that the man's spirit may be saved in the day of the Lord, and that the church may be protected.

Paul's central image comes from Passover. Before the feast, Jewish households purged every trace of leaven. Yeast, working quietly through dough, became a picture of how sin spreads. Paul asks whether they know that a little yeast leavens the whole lump. Tolerated sin does not stay small; it shapes the culture of the whole community.

The gospel grounds his command. Christ, our Passover, has been sacrificed in our place. Believers already are unleavened in Christ, so they should become in practice what they are by grace, keeping the feast with sincerity and truth. Paul clarifies that he is not telling them to withdraw from unbelievers in the world. Church discipline concerns those inside the fellowship; God judges those outside.

Show What You Know

  1. What was Paul's goal in disciplining the man?

  2. Why did yeast become a picture of sin?

  3. What grounds Paul's command to purge the old yeast?

  4. Does Paul tell believers to withdraw from unbelievers in the world?

Crossword

321

Across

  1. For then you would have to leave the ____
  2. Purge out the old ____

Down

  1. But those who are ____

Think About It

  1. Paul says believers should become in practice what they already are by grace. What does it look like to live as someone Christ has made new?

  2. Church correction is meant to rescue, not to punish. How can Christians correct one another in a way that is both truthful and gentle?

Memory Verse

“Purge out the old yeast, that you may be a new lump, even as you are unleavened. For indeed Christ, our Passover, has been sacrificed in our place.”

1 Corinthians 5:7 (WEB)

Copy It

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help a friend turn back to God kindly?
  • What does living in sincerity and truth look like?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.