The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Prints on letter paper in black and white. No answers are printed on the student sheet.

1 Corinthians 5 · Grade 2

A Little Yeast

Name Date

Read the Story

Bakers put a little yeast in dough. The yeast spreads. Soon all the dough puffs up.

Paul said sin is like yeast. A little sin can spread to many people. The church in Corinth had a sin they did not stop. They were proud. They should have been sad.

Jesus died to make His people clean and new. So Paul told them to clean out the old yeast. God wants His people to live in truth.

Memory Verse

“Your boasting is not good. Don’t you know that a little yeast leavens the whole lump?”

1 Corinthians 5:6 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does yeast do in dough?

    Clean and newIt spreadsIn truth

  2. What is sin like?

    YeastIt spreadsIn truth

  3. How should the church have felt?

    It spreadsSadIn truth

  4. What did Jesus make His people?

    In truthClean and newSad

  5. How does God want His people to live?

    In truthYeastIt spreads

Word Search

Find and circle each word. Words go across and down.

WODIYYFLKPUANEBSVADTRSAFPKRLSMTSWIURUINETORUOMDKAWRIPGPENDFLTSARPIKRDTKNMREMOVEDT
  • ARROGANT
  • OUTSIDE
  • INSTEAD
  • REMOVED
  • SPIRIT
  • YEAST
  • WORLD
  • LUMP

Prayer

Dear God, thank You for making me clean and new. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you tell God you are sorry?
  • How can you help a friend do right?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.