The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 14

For teachers and parents. Prints separately from the student sheets.

1 Corinthians 14 · For teachers and parents

Answer Key: Build Each Other Up

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolBuild Each Other Up

peoplescrolltreesun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenAt Church

SING → picture 4PRAY → picture 3LEARN → picture 2HELP → picture 1

Grade 1Build Up the Church

Follow after love. → picture 3Use clear words. → picture 5Help others grow. → picture 2Take turns. → picture 4God is a God of peace. → picture 1

Order:

1. Follow after love and earnestly desire spiritual gifts, but especially that you may prophesy2. I will pray with the spirit, and I will pray with the understanding also3. Let all things be done to build each other up4. Let all things be done decently and in order

Grade 2Words That Help

  1. What did Paul say to follow? Love (circle)
  2. What kind of words help people learn? Clear words (circle)
  3. How should people speak at church? One at a time (circle)
  4. What does God like? Peace (circle)
  5. How should everything be done? In order (circle)
SPEAKSEAPREPRAYGDEHKSPIRITVASSEMBLYISPIRITUALJTMALNHSFELANGUAGELANGUAGESKFANOTHER

Grade 3Decently and in Order

  1. What did Paul want gifts to do? Build up others
  2. What are words without meaning like? A trumpet with an uncertain sound
  3. Why should believers take turns? So everyone can learn
  4. What kind of God is He? A God of peace
1: Follow after love and earnestly desire spiritual gifts, but especially that you may prophesy2: I will pray with the spirit, and I will pray with the understanding also3: Let all things be done to build each other up4: Let all things be done decently and in order
TLGAMSSDUTALSSPPYAANASPIEPKNGNEIRARROUGMRIKALTAUBITSYGHGALTUEFFEEGYKAUDDRSEBLLUSJ

Grade 4Building Up the Church

  1. What three things does prophecy do for others? Builds up, encourages, and comforts
  2. Why did Paul mention a trumpet? It must give a clear sound for soldiers to prepare
  3. How many clear words would Paul rather speak? Five
  4. What might happen if a visitor hears clear truth? His heart may be touched, and he may worship God

Word bank: 1. spiritual; 2. another; 3. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Edification and Order

  1. Why does Paul rank prophecy higher in public worship? It is intelligible and builds up the assembly
  2. What is the guiding test for worship in this chapter? Edification, whether it helps others grow
  3. How might intelligible prophecy affect an outsider? It can convict him so he worships God
  4. Why can prophets take turns and speak in order? The spirits of the prophets are subject to the prophets
3ANOTHER2LAGUAGE4SPEAKS1ASSMBLY

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.