The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 14

Every grade prints starting on a new page. No answers are included.

1 Corinthians 14 · Preschool

Build Each Other Up

Name Date

Color the friends at church. We help each other at church!

Can you find these in the picture? Circle each one!

Bible Verse

“Let all things be done decently and in order.”

1 Corinthians 14:40 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: At church we take turns and use kind words. That helps everyone learn about God.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Kindergarten

At Church

Name Date

Trace the Words

Trace each word with your pencil.

SING
PRAY
LEARN
HELP
Let all things be done decently and in order.

1 Corinthians 14:40 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SING
PRAY
LEARN
HELP

Mini Maze

Help find the way through the maze.

Draw It

Draw people building something together.

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do we do at church?
  • How can you take turns?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Grade 1

Build Up the Church

Name Date

Trace the Words

Trace the words and the verse.

LOVE
WORDS
HELP
TURNS
PEACE
Let all things be done decently and in order.

1 Corinthians 14:40 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Follow after love.
Use clear words.
Help others grow.
Take turns.
God is a God of peace.

Build Each Other Up

Write the number 1 to 4 in each circle to show the right order.

I will pray with the spirit, and I will pray with the understanding also

Let all things be done to build each other up

Let all things be done decently and in order

Follow after love and earnestly desire spiritual gifts, but especially that you may prophesy

Draw people building something together.

Memory Verse

“Let all things be done decently and in order.”

1 Corinthians 14:40 (WEB)

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why do clear words help?
  • What does God like?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Grade 2

Words That Help

Name Date

Read the Story

Paul said to follow love. He wanted the church to use gifts that help others.

Some people at church spoke in other languages. But no one could understand them. Paul said clear words help people learn about God.

Paul said to take turns in church. One person speaks at a time. God likes peace, not mess. Everything should be done in order.

Memory Verse

“So also you, since you are zealous for spiritual gifts, seek that you may abound to the building up of the assembly.”

1 Corinthians 14:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did Paul say to follow?

    Clear wordsLovePeace

  2. What kind of words help people learn?

    LoveClear wordsPeace

  3. How should people speak at church?

    One at a timeIn orderPeace

  4. What does God like?

    Clear wordsIn orderPeace

  5. How should everything be done?

    Clear wordsIn orderPeace

Word Search

Find and circle each word. Words go across and down.

SPEAKSEAPREPRAYGDEHKSPIRITVASSEMBLYISPIRITUALJTMALNHSFELANGUAGELANGUAGESKFANOTHER
  • LANGUAGES
  • SPIRITUAL
  • LANGUAGE
  • ASSEMBLY
  • ANOTHER
  • SPEAKS
  • SPIRIT
  • PRAY

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • When is a good time to listen instead of talk?
  • How can you sit quietly when others are praying?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Grade 3

Decently and in Order

Name Date

Read the Story

Paul said, Follow after love and earnestly desire spiritual gifts. He wanted the church to use gifts that build up others.

Some believers spoke in other languages that no one understood. Paul said that words without meaning are like a trumpet with an uncertain sound. Clear words help people understand and grow.

Paul said that when the church gathers, each one may bring a song or a teaching. But they should take turns, so everyone can learn. God is not a God of confusion but of peace. Paul said, Let all things be done decently and in order.

Memory Verse

“So also you, since you are zealous for spiritual gifts, seek that you may abound to the building up of the assembly.”

1 Corinthians 14:12 (WEB)

Answer the Questions

  1. What did Paul want gifts to do?

  2. What are words without meaning like?

  3. Why should believers take turns?

  4. What kind of God is He?

Build Each Other Up

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

TLGAMSSDUTALSSPPYAANASPIEPKNGNEIRARROUGMRIKALTAUBITSYGHGALTUEFFEEGYKAUDDRSEBLLUSJ
  • LANGUAGES
  • SPIRITUAL
  • LANGUAGE
  • ASSEMBLY
  • ANOTHER
  • SPEAKS
  • SPIRIT
  • PRAY

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you explain your faith so a friend understands?
  • How can you help church time be calm and orderly?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Grade 4

Building Up the Church

Name Date

Read and Think

Paul tells the church to pursue love and to desire spiritual gifts, especially prophecy. Prophecy builds up, encourages, and comforts others. Speaking in another language helps only the speaker unless someone interprets, because no one else understands.

Paul gives examples. A flute or harp must play clear notes for anyone to know the tune, and a trumpet must give a clear sound for soldiers to prepare. In the same way, words in church should be understandable. Paul would rather speak five clear words than ten thousand words no one understands.

Paul also thinks of visitors. If an unbeliever comes in and hears only confusion, he may think the believers are out of their minds. But if he hears clear truth, his heart may be touched, and he may worship God. So Paul gives guidelines: speakers take turns, someone interprets, and others weigh what is said. Everything should be done decently and in order.

Show What You Know

  1. What three things does prophecy do for others?

  2. Why did Paul mention a trumpet?

  3. How many clear words would Paul rather speak?

  4. What might happen if a visitor hears clear truth?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godspiritualanother
  1. Paul tells the church to pursue love and to desire gifts, especially prophecy.
  2. Speaking in language helps only the speaker unless someone interprets, because no one else understands.
  3. But if he hears clear truth, his heart may be touched, and he may worship .

Think About It

  1. Paul wanted worship to build up everyone, including visitors. How can you help a newcomer feel welcome at church?

  2. Clear words help people grow. How can you make sure your words at home and church encourage others?

Memory Verse

“Follow after love and earnestly desire spiritual gifts, but especially that you may prophesy.”

1 Corinthians 14:1 (WEB)

Copy It

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you welcome a newcomer?
  • Who needs a kind word from you this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Corinthians 14 · Grade 5

Edification and Order

Name Date

Read and Think

Chapter 14 applies the way of love to worship. The Corinthians exalted speaking in other languages. Paul does not forbid the gift, and he even speaks in other languages more than they all. But he ranks prophecy higher in public worship because it is intelligible and so builds up the assembly. The guiding test is edification: does this help others grow?

Paul illustrates with musical instruments and a battle trumpet. Sound without clear meaning communicates nothing. The mind matters in worship; Paul will pray and sing with the spirit and with the understanding. He thinks of the outsider who comes in. Uninterpreted languages would seem like madness, but intelligible prophecy can convict him so that the secrets of his heart are revealed and he worships God, declaring that God is truly among them.

Paul closes with practical order. When they gather, each brings a psalm, a teaching, a revelation, or another gift, and all must serve to build each other up. Speakers in other languages should take turns, with interpretation. Prophets should speak in turn while others weigh what is said, because the spirits of the prophets are subject to the prophets. God is not a God of confusion but of peace. Paul's final word summarizes the chapter: let all things be done decently and in order.

Show What You Know

  1. Why does Paul rank prophecy higher in public worship?

  2. What is the guiding test for worship in this chapter?

  3. How might intelligible prophecy affect an outsider?

  4. Why can prophets take turns and speak in order?

Crossword

3241

Across

  1. For if I pray in ____ language
  2. If any man ____ in another language

Down

  1. That the ____ may be built up
  2. He who speaks in another ____ edifies himself
  3. Therefore other ____ are for a sign

Think About It

  1. Paul measures worship by whether it builds others up. How might that test change the way you take part in a worship service?

  2. Paul says God is a God of peace, not confusion. What practices help a church gathering reflect God's peace?

Memory Verse

“Follow after love and earnestly desire spiritual gifts, but especially that you may prophesy.”

1 Corinthians 14:1 (WEB)

Copy It

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help others worship when you go to church?
  • How can a church reflect God's peace?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.