The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 14

Prints on letter paper in black and white. No answers are printed on the student sheet.

1 Corinthians 14 · Grade 2

Words That Help

Name Date

Read the Story

Paul said to follow love. He wanted the church to use gifts that help others.

Some people at church spoke in other languages. But no one could understand them. Paul said clear words help people learn about God.

Paul said to take turns in church. One person speaks at a time. God likes peace, not mess. Everything should be done in order.

Memory Verse

“So also you, since you are zealous for spiritual gifts, seek that you may abound to the building up of the assembly.”

1 Corinthians 14:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did Paul say to follow?

    Clear wordsLovePeace

  2. What kind of words help people learn?

    LoveClear wordsPeace

  3. How should people speak at church?

    One at a timeIn orderPeace

  4. What does God like?

    Clear wordsIn orderPeace

  5. How should everything be done?

    Clear wordsIn orderPeace

Word Search

Find and circle each word. Words go across and down.

SPEAKSEAPREPRAYGDEHKSPIRITVASSEMBLYISPIRITUALJTMALNHSFELANGUAGELANGUAGESKFANOTHER
  • LANGUAGES
  • SPIRITUAL
  • LANGUAGE
  • ASSEMBLY
  • ANOTHER
  • SPEAKS
  • SPIRIT
  • PRAY

Prayer

Dear God, thank You for the church where we help each other. Help me . Amen.

Take It Home

For families: talk about these together.

  • When is a good time to listen instead of talk?
  • How can you sit quietly when others are praying?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.