The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 9

Every grade prints starting on a new page. No answers are included.

1 Chronicles 9 · Preschool

Keepers of the Doors

Name Date

Color the door and the keys. Helpers opened God's house every morning.

Can you find these in the picture? Circle each one!

Bible Verse

“They stayed around God’s house, because that was their duty; and it was their duty to open it morning by morning.”

1 Chronicles 9:27 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Some helpers opened God's house every morning. We can help at church too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Kindergarten

Open the Door

Name Date

Trace the Words

Trace each word with your pencil.

DOOR
OPEN
HOUSE
GOD
Phinehas the son of Eleazar was ruler over them in time past, and Yahweh was with him.

1 Chronicles 9:20 (WEB)

Match the Pictures

Draw a line from each word to its picture.

DOOR
KEY
LAMP
BREAD

Mini Maze

Help find the way through the maze.

Draw It

Draw a gatekeeper at God's house.

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do you do every morning?
  • How can you help at church?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Grade 1

Helpers in God's House

Name Date

Trace the Words

Trace the words and the verse.

GATES
MORNING
SINGERS
LEVITES
Zechariah the son of Meshelemiah was gatekeeper of the door of the Tent of Meeting.

1 Chronicles 9:21 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The people came home.
Gatekeepers kept the doors.
They opened it every morning.
Some made the bread.
Singers worked day and night.

Back in Jerusalem

Write the number 1 to 4 in each circle to show the right order.

They were the gatekeepers for the camp of the children of Levi

They stayed around God’s house

These are the singers

So all Israel were listed by genealogies

Draw a gatekeeper at God's house.

Memory Verse

“Zechariah the son of Meshelemiah was gatekeeper of the door of the Tent of Meeting.”

1 Chronicles 9:21 (WEB)

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who opened God's house?
  • When did they open the doors?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Grade 2

Morning by Morning

Name Date

Read the Story

God's people had to go far away. Later they came back home. They lived in Jerusalem again.

Some men kept the gates of God's house. They kept watch on all four sides. They opened the doors every morning.

Some helpers made the bread. Some took care of the cups and bowls. The singers worked day and night.

Memory Verse

“They stayed around God’s house, because that was their duty; and it was their duty to open it morning by morning.”

1 Chronicles 9:27 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where did the people live again?

    Every morningDay and nightIn Jerusalem

  2. What did some men keep?

  3. When did they open the doors?

    Every morningDay and nightThe gates of God's house

  4. What did some helpers make?

    Every morningThe breadIn Jerusalem

  5. When did the singers work?

    In JerusalemThe gates of God's houseDay and night

Word Search

Find and circle each word. Words go across and down.

SCGMBKBCSLSIGANRLENEISWYOVRHJVNRHTBVAOUIGAHGILAUDTEEICJRSSAERLEFYVVEHSSUYGATESVAP
  • BROTHERS
  • LEVITES
  • SINGERS
  • SERVICE
  • ISRAEL
  • HOUSE
  • GATES
  • JUDAH

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did Judah go to Babylon?
  • Who worked day and night?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Grade 3

The People Come Home

Name Date

Read the Story

All Israel was listed by family. Judah had been carried away to Babylon because they did not obey. Later some came home and lived in their cities again.

In Jerusalem there were priests and Levites. There were gatekeepers too. They guarded the gates of Yahweh's house on the east, west, north, and south.

The gatekeepers opened God's house morning by morning. Some Levites took care of the vessels, the flour, the oil, and the spices. Others made the bread. The singers were busy day and night.

Memory Verse

“Now the first inhabitants who lived in their possessions in their cities were Israel, the priests, the Levites, and the temple servants.”

1 Chronicles 9:2 (WEB)

Answer the Questions

  1. Why was Judah carried away to Babylon?

  2. Who lived in Jerusalem?

  3. Which sides did the gatekeepers guard?

  4. When did they open God's house?

  5. When were the singers busy?

Back in Jerusalem

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

LOSIJIYBEEBHESUEYGVHRGRRDAPIOJOAVAAGTUSWTTIEHESNFGHECLSEGWHYESESINGERSRFPKKIPDFFS
  • BROTHERS
  • LEVITES
  • SINGERS
  • SERVICE
  • ISRAEL
  • HOUSE
  • GATES
  • JUDAH

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why do small jobs matter to God?
  • How can you be a helper God can trust?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Grade 4

Faithful in Small Jobs

Name Date

Read and Think

Chapter 9 ends the long family lists. It shows who lived in Jerusalem after the exile. Verse 1 says Judah had been carried away to Babylon because they did not obey. The first people back were Israelites, priests, Levites, and temple servants.

The gatekeepers had an office of trust. David and Samuel the seer had first set them in their work. They guarded the gates on all four sides, stayed around God's house at night, and opened it morning by morning (9:27).

Other Levites counted the vessels in and out, cared for the flour, wine, oil, and spices, and prepared the show bread every Sabbath. The singers were employed in their work day and night. The chapter ends by repeating Saul's family, which leads into the story of Saul's last day.

Show What You Know

  1. Who were the first people back?

  2. Who first set the gatekeepers in their work?

  3. What did the gatekeepers do each morning?

  4. When was the show bread prepared?

  5. What does the chapter lead into?

Word Bank Fill-In

Use the word bank to fill in each blank.

JudahLevitessingers
  1. Verse 1 says had been carried away to Babylon because they did not obey.
  2. The first people back were Israelites, priests, , and temple servants.
  3. The were employed in their work day and night.

Think About It

  1. Opening doors and counting cups may seem like small jobs. How does God see faithful work in small things?

  2. The gatekeepers served in an office of trust. How can you be someone others can trust?

Memory Verse

“They stayed around God’s house, because that was their duty; and it was their duty to open it morning by morning.”

1 Chronicles 9:27 (WEB)

Copy It

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does an office of trust mean?
  • How does Luke 16:10 in the New Testament connect to the gatekeepers?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

1 Chronicles 9 · Grade 5

An Office of Trust

Name Date

Read and Think

The genealogies end where the Chronicler's first readers lived: in Jerusalem after the return from exile. Verse 1 sums up the past in one line: Judah was carried away captive to Babylon for their disobedience. Then verses 2-34 list who came back and settled, from the tribes of Judah, Benjamin, Ephraim, and Manasseh, to the priests and Levites.

The gatekeepers receive special attention. They numbered two hundred twelve, and David and Samuel the seer had ordained them in their office of trust. Four chief gatekeepers were over the rooms and the treasuries. They stayed around God's house through the night and opened it morning by morning.

Other Levites had duties that sound ordinary: counting the vessels of service in and out, mixing the spices, baking in pans, and preparing the show bread every Sabbath. The singers were free from other service because they worked day and night. Every task, great or small, was part of worship. In the New Testament, Jesus taught that whoever is faithful in a very little is faithful also in much (Luke 16:10).

Show What You Know

  1. What one line sums up the past in verse 1?

  2. How many gatekeepers were there?

  3. Who ordained the gatekeepers?

  4. Why were the singers free from other service?

  5. What did Jesus teach in Luke 16:10?

Crossword

41235

Across

  1. Heads of fathers’ households of the ____
  2. And their ____ (Shallum was the chief)

Down

  1. The ruler of God’s ____
  2. Were over the work of the ____
  3. These are the ____

Think About It

  1. The Levites counted cups and baked bread as part of worship. How can ordinary tasks in your week become worship?

  2. The gatekeepers opened God's house morning by morning. What faithful habit could you start each morning?

Memory Verse

“All these who were chosen to be gatekeepers in the thresholds were two hundred twelve. These were listed by genealogy in their villages, whom David and Samuel the seer ordained in their office of trust.”

1 Chronicles 9:22 (WEB)

Copy It

Prayer

Dear God, thank You for people who serve You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What ordinary task can you do as worship this week?
  • How can you be faithful in little things?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.