The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 87

Every grade prints starting on a new page. No answers are included.

Psalms 87 · Preschool

City of God

Name Date

Color the city and the people from many lands. God welcomes people from everywhere.

Can you find these in the picture? Circle each one!

Bible Verse

“Glorious things are spoken about you, city of God. Selah.”

Psalms 87:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God's city is wonderful! He welcomes people from every land. Let's dance and sing!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Kindergarten

God's City

Name Date

Trace the Words

Trace each word with your pencil.

CITY
GATES
SING
DANCE
Glorious things are spoken about you, city of God. Selah.

Psalms 87:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

CITY
PEOPLE
SING
SPRINGS

Mini Maze

Help find the way through the maze.

Draw It

Draw the gates of God's city.

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where do you like to visit?
  • Who does God welcome?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Grade 1

Glorious Things

Name Date

Trace the Words

Trace the words and the verse.

ZION
GATES
BORN
SPRINGS
Glorious things are spoken about you, city of God. Selah.

Psalms 87:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Glorious things are said of you.
His foundation is in the holy mountains.
This one was born there.
God writes their names.
All my springs are in you.

Born in Zion

Write the number 1 to 4 in each circle to show the right order.

Yahweh loves the gates of Zion

His foundation is in the holy mountains

I will record Rahab and Babylon among those who acknowledge me

Yahweh will count, when he writes up the peoples

Draw the gates of God's city.

Memory Verse

“Glorious things are spoken about you, city of God. Selah.”

Psalms 87:3 (WEB)

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel to belong to God's family?
  • What do people do in God's city?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Grade 2

God's City

Name Date

Read the Story

God loves his city, Zion. Wonderful things are said about it. God's city is on a holy mountain.

People from many lands will belong there. God will write their names. He will say, This one was born there. People will sing and dance.

Memory Verse

“Glorious things are spoken about you, city of God. Selah.”

Psalms 87:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What city does God love?

    Their namesOn a holy mountainZion

  2. Where is God's city?

    People from many landsZionOn a holy mountain

  3. Who will belong there?

    People from many landsOn a holy mountainZion

  4. What will God write?

    ZionPeople from many landsTheir names

  5. What will people do?

    Sing and danceOn a holy mountainPeople from many lands

Word Search

Find and circle each word. Words go across and down.

MOUNTAINSRSPRINGSRBMLRFGUAEOZGCEFOSRRISAICCFCNOGUTTOAGNNBBGEYREETDRORSMDTVIWIMUJR
  • MOUNTAINS
  • SPRINGS
  • RECORD
  • GATES
  • ZION
  • CITY
  • BORN

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • God keeps a list of His own. How can you show love to your church?
  • God's family is made of many nations. How can you welcome a new friend?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Grade 3

This One Was Born There

Name Date

Read the Story

The title of Psalm 87 calls it a Psalm and Song by the sons of Korah. His foundation is in the holy mountains. Yahweh loves the gates of Zion. Glorious things are spoken about you, city of God.

God names many nations, like Babylon, Philistia, Tyre and Ethiopia. He says they will be among those who acknowledge him. Of each one it is said, This one was born there.

Yahweh will count, when he writes up the peoples. The singers and the dancers will say, All my springs are in you.

Memory Verse

“Glorious things are spoken about you, city of God. Selah.”

Psalms 87:3 (WEB)

Answer the Questions

  1. What does Yahweh love?

  2. What is spoken about the city of God?

  3. Name two nations God names.

  4. What is said of each one?

  5. What do the singers say?

Born in Zion

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

MHYOSIOTZROSSSJMAIEPUPJPPDOCWCNRBUGNOAIFTIOSCRBTTFANREDPYDNMIGNLYGATESNSKYGAVTNMS
  • MOUNTAINS
  • SPRINGS
  • RECORD
  • GATES
  • ZION
  • CITY
  • BORN

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • God will count people from many nations as His. How can you be kind to people from other places?
  • How do you know you are part of God's family?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Grade 4

Citizens of Zion

Name Date

Read and Think

The title of Psalm 87 calls it a Psalm by the sons of Korah. It is short but surprising. It praises Zion, Jerusalem, as the city God loves. His foundation is in the holy mountains. Yahweh loves the gates of Zion more than all the dwellings of Jacob. Glorious things are spoken about you, city of God.

Then God lists nations that were often Israel's enemies: Rahab, a poetic name many think means Egypt, and Babylon, Philistia, Tyre and Ethiopia. God says, I will record Rahab and Babylon among those who acknowledge me. Of each it is said, This one was born there. People from other nations will be counted as citizens of Zion.

God himself keeps the record. Yahweh will count, when he writes up the peoples, This one was born there. The psalm ends with joy: Those who sing as well as those who dance say, All my springs are in you. God is the source of every good thing.

Show What You Know

  1. What does Yahweh love more than the dwellings of Jacob?

  2. What do many think Rahab means here?

  3. What surprising thing does God say about other nations?

  4. What does All my springs are in you mean?

Word Bank Fill-In

Use the word bank to fill in each blank.

cityZiongatesrecordmountains
  1. It praises , Jerusalem, as the city God loves.
  2. His foundation is in the holy .
  3. Yahweh loves the of Zion more than all the dwellings of Jacob.
  4. Glorious things are spoken about you, of God.
  5. God says, I will Rahab and Babylon among those who acknowledge me.

Think About It

  1. Why is it good news that God welcomes people from every nation?

  2. What are some good things that spring from God in your life?

Memory Verse

“Yes, of Zion it will be said, “This one and that one was born in her;” the Most High himself will establish her.”

Psalms 87:5 (WEB)

Copy It

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who keeps the record of the peoples?
  • God's city includes former enemies. How could you welcome someone very different from you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 87 · Grade 5

Glorious Things of Thee Are Spoken

Name Date

Read and Think

The title of Psalm 87 calls it a Psalm by the sons of Korah, a Song. Its seven verses carry a vision that reaches far beyond Israel. It opens with Zion, founded by God on the holy mountains. Yahweh loves the gates of Zion more than all the dwellings of Jacob. Glorious things are spoken about you, city of God. These words later inspired the hymn Glorious Things of Thee Are Spoken.

The surprise comes in verse 4. God names nations that were Israel's oppressors or rivals: Rahab, often understood as a poetic name for Egypt, Babylon, Philistia, Tyre and Ethiopia. I will record Rahab and Babylon among those who acknowledge me. Of each one, God says, This one was born there. Foreigners are not merely visitors; they are enrolled as native-born citizens of Zion.

God keeps the register himself: Yahweh will count, when he writes up the peoples, This one was born there. Many Christians see this as pointing toward the gospel bringing people of every nation into God's family, as in the New Testament book of Galatians (4:26), which calls the Jerusalem above our mother. The psalm closes with festive music: All my springs are in you.

Show What You Know

  1. What hymn did verse 3 later inspire?

  2. Why is verse 4 surprising?

  3. What does it mean to be enrolled as native-born?

  4. How do many Christians read this psalm?

Crossword

52341

Across

  1. I will ____ Rahab and Babylon among those who acknowledge me.
  2. Of ____ it will be said.

Down

  1. All my ____ are in you.
  2. His foundation is in the holy ____.
  3. This one and that one was ____ in her.

Think About It

  1. How should this psalm shape how we treat people from other nations?

  2. What does it mean to you that God writes your name?

Memory Verse

“Yahweh will count, when he writes up the peoples, “This one was born there.” Selah.”

Psalms 87:6 (WEB)

Copy It

Prayer

Dear God, thank You for welcoming people from every nation. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you make friends with someone from another country?
  • How can we welcome people from other lands?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.