The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 13

Every grade prints starting on a new page. No answers are included.

Joshua 13 · Preschool

God Is Our Gift

Name Date

Color the hills of the land God gave His people.

Can you find these in the picture? Circle each one!

Bible Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Say: The Levites did not get land. God Himself was their gift! God is the best gift of all.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Kindergarten

God Gives

Name Date

Trace the Words

Trace each word with your pencil.

LAND
GIFT
GOD
OLD
But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.

Joshua 13:33 (WEB)

Match the Pictures

Draw a line from each word to its picture.

JOSHUA
LAND
GOD'S WORD
GIFT

Mini Maze

Help find the way through the maze.

Draw It

Draw a gift God has given you.

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • What tribe did not get land?
  • What is the best gift?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Grade 1

Land for the Tribes

Name Date

Trace the Words

Trace the words and the verse.

LAND
LEVI
TRIBES
SHARE
But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.

Joshua 13:33 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Joshua was old.
Much land was still left.
God said, I will drive them out.
Joshua must share the land.
God was Levi's gift.

Land Still to Take

Write the number 1 to 4 in each circle to show the right order.

Now Joshua was old

Yahweh, the God of Israel, is their inheritance

I will drive them out from before the children of Israel

he gave no inheritance to the tribe of Levi

Draw a gift God has given you.

Memory Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who was old now?
  • What gift has God given you?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Grade 2

God Is Their Gift

Name Date

Read the Story

Joshua was old now. God said, You are old. There is still much land left.

God said He would drive out the people there. He told Joshua to share the land with the tribes. Each tribe will get a part.

Moses had given land east of the Jordan to two and a half tribes. But the tribe of Levi did not get land. God Himself was their gift.

Memory Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How old was Joshua?

    Two and a half tribesGod HimselfHe was old now

  2. What did God say was left?

    Two and a half tribesGod HimselfMuch land

  3. Who would drive out the people?

    GodMuch landTwo and a half tribes

  4. Who got land east of the Jordan?

  5. What was the gift of the tribe of Levi?

    Two and a half tribesGod HimselfMuch land

Word Search

Find and circle each word. Words go across and down.

LBBOLDGKUAGAFEAFKGNOLRGLRJSDBAEVLKFGBJAUFOUMAVLMBOCMEDYAREMAINSWWANFTYCWNLEVIEVTJ
  • ALLOCATE
  • REMAINS
  • REUBEN
  • BALAAM
  • LAND
  • LEVI
  • OLD
  • GAD

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • What work has God still left for you to do?
  • How do you feel when you start a job that is not done yet?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Grade 3

Yahweh Is Their Inheritance

Name Date

Read the Story

Now Joshua was old. Yahweh said there was still very much land to be possessed. God named the lands of the Philistines and other peoples.

Yahweh said, I will drive them out from before the children of Israel. Joshua's job was to divide the land. It would go to the nine tribes and the half-tribe of Manasseh.

Moses had already given land east of the Jordan to Reuben, Gad, and half of Manasseh. But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance.

Memory Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Answer the Questions

  1. How does the chapter describe Joshua?

  2. Whose lands did God name as still to be possessed?

  3. Who would drive the peoples out?

  4. To whom was Joshua to divide the land?

  5. What was the inheritance of the tribe of Levi?

Land Still to Take

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

PYRGADORKOBENABLEERHUDLAEMRJPBHLLVAGATEHOAIIJFGNDCAFNULANDAMISIVOLDTTDUNUBYYEVNRT
  • ALLOCATE
  • REMAINS
  • REUBEN
  • BALAAM
  • LAND
  • LEVI
  • OLD
  • GAD

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did the Levites not need land?
  • How can older people serve God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Grade 4

An Unfinished Task

Name Date

Read and Think

Joshua 13 marks a turn in the book from taking the land to sharing it. Joshua was old. Yahweh told him plainly that very much land was left to be possessed. The work was not done. But God promised, I will drive them out from before the children of Israel.

God told Joshua to allocate it to Israel for an inheritance, as I have commanded you. Joshua did not need to wait for every enemy to be gone. He could act on God's promise.

The chapter recalls the land Moses gave east of the Jordan to Reuben, Gad, and half of Manasseh. Twice the chapter notes that Levi received no land. The offerings of Yahweh made by fire were Levi's inheritance, and Yahweh Himself was their inheritance.

Show What You Know

  1. What turn does the book take in chapter 13?

  2. What promise did God make about the remaining land?

  3. Why could Joshua divide the land before every enemy was gone?

  4. How many times does the chapter note that Levi received no land?

Word Bank Fill-In

Use the word bank to fill in each blank.

GodallocatelandReubenold
  1. Joshua 13 marks a turn in the book from taking the to sharing it.
  2. Joshua was .
  3. But promised, I will drive them out from before the children of Israel.
  4. God told Joshua to it to Israel for an inheritance, as I have commanded you.
  5. The chapter recalls the land Moses gave east of the Jordan to , Gad, and half of Manasseh.

Think About It

  1. Joshua was old, but God still had work for him. How can people of every age serve God?

  2. The Levites had God as their inheritance. What would it mean for God to be your greatest treasure?

Memory Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Copy It

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did God tell Joshua to share the land now?
  • What does it mean that God is an inheritance?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Joshua 13 · Grade 5

Dividing by Faith

Name Date

Read and Think

Joshua 13 opens the second half of the book. Now Joshua was old and well advanced in years, and Yahweh says, there remains yet very much land to be possessed. God lists regions still held by others, including the Philistines, the Geshurites, and lands toward Lebanon. Yet He promises, I will drive them out from before the children of Israel.

God's instruction is surprising: Just allocate it to Israel for an inheritance. Joshua is to divide land Israel does not yet fully hold. Dividing the land becomes an act of faith in God's future action. The chapter also admits that Israel did not drive out the Geshurites nor the Maacathites, a quiet warning of unfinished obedience.

Most of the chapter recalls the inheritance Moses gave east of the Jordan to Reuben, Gad, and half of Manasseh. Yet two notes frame Levi's share: the offerings of Yahweh made by fire are his inheritance, and Yahweh, the God of Israel, is their inheritance. The Levites' portion shows that the greatest gift in the promised land is the Lord Himself.

Show What You Know

  1. Which part of the book does chapter 13 open?

  2. Why is dividing land not yet fully held an act of faith?

  3. Which peoples did Israel not drive out?

  4. What two things are named as Levi's inheritance?

  5. What does the Levites' portion show?

Crossword

51234

Across

  1. The tribe with no land inheritance.
  2. Just ____ it to Israel for an inheritance.

Down

  1. A tribe east of the Jordan.
  2. there remains yet very ____ land to be possessed.
  3. Joshua was ____ and well advanced in years.

Think About It

  1. Joshua divided land God had promised but not yet given in full. Where do you need to act on God's promises before you see them complete?

  2. What do you treasure most? How could the Levites' example shape your answer?

Memory Verse

“But Moses gave no inheritance to the tribe of Levi. Yahweh, the God of Israel, is their inheritance, as he spoke to them.”

Joshua 13:33 (WEB)

Copy It

Prayer

Dear God, thank You for being my greatest gift. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you learn from older people who still serve God?
  • How can you treasure God more than things?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.