The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 2

Prints on letter paper in black and white. No answers are printed on the student sheet.

John 2 · Grade 2

Whatever He Says

Name Date

Read the Story

Jesus and His friends went to a wedding. There was a big party. But the drinks ran out!

Mary, the mother of Jesus, said to the helpers, Do whatever Jesus tells you. Jesus told them to fill six big jars with water. They filled them to the top.

The water turned into the very best wine! This was the first sign Jesus did. It showed His glory. His friends believed in Him.

Memory Verse

His mother said to the servants, “Whatever he says to you, do it.”

John 2:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where did Jesus and His friends go?

    The drinks (wine)SixTo a wedding

  2. What ran out at the party?

    They believed in HimTo a weddingThe drinks (wine)

  3. What did Mary tell the helpers?

  4. How many jars did they fill with water?

    They believed in HimSixThe drinks (wine)

  5. What did the friends do after they saw the sign?

    SixTo a weddingThey believed in Him

Word Search

Find and circle each word. Words go across and down.

OBJOSWMGUSWEGCIWOPCTELYNGVWAECDIEHNANMHWDEEHTAPFSHIVOEULCEARNERFENUFOBGUWATERPOTS
  • WATERPOTS
  • BELIEVE
  • WEDDING
  • TEMPLE
  • WATER
  • WINE
  • CANA
  • SIGN

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus helped at a family celebration. How can you help when someone needs it?
  • Jesus did His first miracle with plain water. What can you thank Jesus for today?
  • Why was Jesus upset in the temple?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.