The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 5 · Grade 2

Seek God

Name Date

Read the Story

Eliphaz kept talking. He said that if he were Job, he would seek God. He said God does great things. God gives rain on the earth. God sends water on the fields.

Eliphaz said God helps the poor. He said the poor have hope. These things about God are true.

But Eliphaz also thought God was punishing Job for sin. That was not true. Eliphaz was wrong about Job. At the end, God said the friends did not speak what was right.

Memory Verse

“So the poor has hope, and injustice shuts her mouth.”

Job 5:16 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What would Eliphaz do if he were Job?

    Punishing him for sinRainHe would seek God

  2. What does God give on the earth?

    Punishing him for sinRainThe poor

  3. Who has hope?

    He would seek GodThe poorRain

  4. What did Eliphaz think God was doing to Job?

    The poorPunishing him for sinRain

  5. Was Eliphaz right about Job?

Word Search

Find and circle each word. Words go across and down.

SNUSRURJDCDEWTRAGPSCPEPVIRVFHHCDMNEKLIWOHYIANWKEHPACTPBIRLOEPIBSNSADLWPREMVEDSEJY
  • FIELDS
  • GREAT
  • NEEDY
  • HAPPY
  • WHOLE
  • RAIN
  • WISE
  • HOPE

Prayer

Dear God, thank You for sending rain and good gifts. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God take care of you?
  • Why should we be careful before we say someone did wrong?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.