The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 42

Every grade prints starting on a new page. No answers are included.

Job 42 · Preschool

God Blesses Job

Name Date

Color Job and his family! God blessed Job again.

Can you find these in the picture? Circle each one!

Bible Verse

“Yahweh restored Job’s prosperity when he prayed for his friends. Yahweh gave Job twice as much as he had before.”

Job 42:10 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Job prayed for his friends. Then God blessed Job with twice as much as before. God is kind and good. Let's pray for our friends today.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Kindergarten

Blessed

Name Date

Trace the Words

Trace each word with your pencil.

PRAY
FRIENDS
BLESS
TWICE
I had heard of you by the hearing of the ear, but now my eye sees you.

Job 42:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

PRAY
FRIENDS
BLESS
TWICE

Mini Maze

Help find the way through the maze.

Draw It

Draw Job with his new family.

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did God give Job at the end?
  • What good things has God given your family?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Grade 1

Job Is Blessed

Name Date

Trace the Words

Trace the words and the verse.

SEES
PRAY
FAMILY
TWICE
I had heard of you by the hearing of the ear, but now my eye sees you.

Job 42:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Job said, Now my eye sees you.
Job prayed for his friends.
God gave Job a new family.
God gave Job twice as much.
God is kind and good.

God Blesses Job

Write the number 1 to 4 in each circle to show the right order.

Yahweh gave Job twice as much as he had before

but now my eye sees you

when he prayed for his friends

I know that you can do all things

Draw Job with his new family.

Memory Verse

“I had heard of you by the hearing of the ear, but now my eye sees you.”

Job 42:5 (WEB)

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who can you pray for today?
  • Where do you notice God's care?
  • How do you feel when someone is kind to you after you were unkind?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Grade 2

God Blesses Job

Name Date

Read the Story

Job told God, I know that you can do all things. Job said he had only heard about God before. Now he knew God much better.

God said Job's friends had not spoken what is right about Him. God told Job to pray for his friends. Job prayed for them.

God gave Job twice as much as he had before. God gave him seven sons and three daughters. Job lived a long, happy life.

Memory Verse

“Yahweh restored Job’s prosperity when he prayed for his friends. Yahweh gave Job twice as much as he had before.”

Job 42:10 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did Job say God can do?

  2. What did God tell Job to do?

  3. How much did God give Job?

  4. How many sons and daughters did Job have?

Word Search

Find and circle each word. Words go across and down.

DPCDTWICEEARSMWSEFMMUANUOERORTGYGNPINSIHHESMEFDKLITDDNTAIYLNEADJYFEYEGRSVSYLJHPSS
  • DAUGHTERS
  • FRIENDS
  • THINGS
  • PRAYED
  • TWICE
  • SONS
  • DAYS
  • EYE

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you feel when God gives you good things again?
  • Why does God care about how we talk about Him?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Grade 3

Now My Eye Sees You

Name Date

Read the Story

Job answered Yahweh, I know that you can do all things. He said, I had heard of you by the hearing of the ear, but now my eye sees you. Job was sorry for the things he had said.

Yahweh spoke to Eliphaz. God said He was angry with him and his two friends, because they had not spoken of Him what is right, as His servant Job had. The friends had been wrong to say Job was suffering for his sins.

The friends brought an offering, and Job prayed for them. Yahweh restored Job's prosperity when he prayed for his friends. Yahweh gave Job twice as much as he had before. Job lived one hundred forty years.

Memory Verse

“I had heard of you by the hearing of the ear, but now my eye sees you.”

Job 42:5 (WEB)

Answer the Questions

  1. What did Job say God can do?

  2. What did Job say about his eye?

  3. Why was God angry with the friends?

  4. When did Yahweh restore Job's prosperity?

God Blesses Job

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

DTWICECYJFAHUFITLYFRUIIIDHEEMIGNOASLBMNEHGYOEHIMRNTSNGAEYEVDESVWJFSVVSRTOSPRAYEDS
  • DAUGHTERS
  • FRIENDS
  • THINGS
  • PRAYED
  • TWICE
  • SONS
  • DAYS
  • EYE

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you feel when God gives you a fresh start?
  • How can you forgive someone who has hurt you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Grade 4

The Friends Corrected

Name Date

Read and Think

Job answered Yahweh, I know that you can do all things, and that no purpose of yours can be restrained. Job admitted that he had spoken of things too wonderful for him, which he did not know. I had heard of you by the hearing of the ear, but now my eye sees you. Therefore I abhor myself, and repent in dust and ashes.

Then Yahweh spoke to Eliphaz. God said His wrath was kindled against him and his two friends, for they had not spoken of Him the thing that is right, as His servant Job had. This settles the long debate. The friends kept saying Job must have sinned, but they were wrong. God told them to offer a burnt offering and said His servant Job would pray for them.

Yahweh restored Job's prosperity when he prayed for his friends. Yahweh gave Job twice as much as he had before. His family came to comfort him. He had also seven sons and three daughters. After this Job lived one hundred forty years. In the New Testament, James writes that you have heard of the perseverance of Job and have seen how the Lord is full of compassion and mercy (James 5:11).

Show What You Know

  1. What did Job know about God?

  2. What did Job do in dust and ashes?

  3. Why was God angry with Eliphaz and his friends?

  4. What did God tell the friends to offer?

  5. How long did Job live after this?

Word Bank Fill-In

Use the word bank to fill in each blank.

twiceeyethingsGodfriends
  1. Job answered Yahweh, I know that you can do all , and that no purpose of yours can be restrained.
  2. I had heard of you by the hearing of the ear, but now my sees you.
  3. God said His wrath was kindled against him and his two , for they had not spoken of Him the thing that is right, as His servant Job had.
  4. told them to offer a burnt offering and said His servant Job would pray for them.
  5. Yahweh gave Job as much as he had before.

Think About It

  1. Job said, Now my eye sees you. How can hard times help you know God better, not just know about Him?

  2. Job prayed for the friends who had hurt him. Who is someone you can pray for even if they have been unkind?

Memory Verse

“I had heard of you by the hearing of the ear, but now my eye sees you.”

Job 42:5 (WEB)

Copy It

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can knowing God better change you?
  • How can you stay God's faithful servant through hard times?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 42 · Grade 5

The End of the Lord's Purpose

Name Date

Read and Think

Job answers Yahweh with humility: I know that you can do all things, and that no purpose of yours can be restrained. He admits he had spoken of things too wonderful for him. I had heard of you by the hearing of the ear, but now my eye sees you. Therefore I abhor myself, and repent in dust and ashes. Job is not confessing a hidden sin that caused his suffering; he repents of speaking about God without knowledge.

Then Yahweh speaks to Eliphaz the Temanite. His wrath is kindled against Eliphaz and his two friends, for they have not spoken of Him the thing that is right, as His servant Job has. This is God's verdict on the dialogue. The friends had defended God with false claims, insisting that Job's suffering proved his guilt. Job had said hard things, but he spoke honestly to God. The friends must bring seven bulls and seven rams, and Job will pray for them.

Yahweh restored Job's prosperity when he prayed for his friends. Yahweh gave Job twice as much as he had before. He had also seven sons and three daughters, and in all the land were no women found so beautiful as the daughters of Job. So Job died, being old and full of days. In the New Testament, James writes that you have heard of the perseverance of Job and have seen the Lord in the outcome, and how the Lord is full of compassion and mercy (James 5:11).

Show What You Know

  1. What did Job know about God's purposes?

  2. What did Job repent of?

  3. What was God's verdict on the friends?

  4. What had the friends insisted?

  5. What does James say we have seen?

Crossword

42513

Across

  1. but now my ____ sees you
  2. So Job died, being old and full of ____.

Down

  1. Yahweh gave Job ____ as much as he had before.
  2. when he ____ for his friends
  3. I know that you can do all ____

Think About It

  1. The friends defended God with false claims. Why does God care that we speak truthfully about Him?

  2. Job's story ends with God's compassion and mercy. How can this ending help you keep trusting God during a hard time?

Memory Verse

“I had heard of you by the hearing of the ear, but now my eye sees you.”

Job 42:5 (WEB)

Copy It

Prayer

Dear God, thank You for blessing people who trust You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who can you pray for even if they have been unkind?
  • How can Job's ending help you trust God in hard times?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.