The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 32

Every grade prints starting on a new page. No answers are included.

Job 32 · Preschool

The Spirit Gives Understanding

Name Date

Color young Elihu listening! He waited his turn to speak.

Can you find these in the picture? Circle each one!

Bible Verse

“But there is a spirit in man, and the Spirit of the Almighty gives them understanding.”

Job 32:8 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Elihu waited his turn to talk. God gives understanding to young and old people.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Kindergarten

Wait

Name Date

Trace the Words

Trace each word with your pencil.

WAIT
LISTEN
YOUNG
TURN
Now Elihu had waited to speak to Job, because they were older than he.

Job 32:4 (WEB)

Match the Pictures

Draw a line from each word to its picture.

ELIHU
FRIENDS
WAIT
HEART

Mini Maze

Help find the way through the maze.

Draw It

Draw a young person listening before speaking.

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is it good to wait your turn?
  • Who gives understanding?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Grade 1

Elihu Waits

Name Date

Trace the Words

Trace the words and the verse.

WAITED
LISTEN
YOUNG
OLDER
Now Elihu had waited to speak to Job, because they were older than he.

Job 32:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The friends stopped talking.
Young Elihu had been listening.
He waited his turn.
God gives understanding.
Elihu was full of words.

Elihu Speaks

Write the number 1 to 4 in each circle to show the right order.

the Spirit of the Almighty gives them understanding

I am young, and you are very old

Elihu had waited to speak to Job

there is a spirit in man

Draw a young person listening before speaking.

Memory Verse

“Now Elihu had waited to speak to Job, because they were older than he.”

Job 32:4 (WEB)

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who stopped talking?
  • Who was Elihu?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Grade 2

Elihu Waited

Name Date

Read the Story

Job's three friends stopped talking. They had no more to say.

A young man named Elihu was there. He had been listening. He waited to talk because the others were older.

Elihu said God gives understanding to people. Elihu was full of words. Now it was his turn to talk. Elihu said some true things about God, but God Himself has the final word.

Memory Verse

“Now Elihu had waited to speak to Job, because they were older than he.”

Job 32:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who stopped talking?

    GodJob's three friendsListening

  2. What was the young man's name?

    ElihuThe others were olderListening

  3. What had Elihu been doing?

    Job's three friendsListeningGod

  4. Why did Elihu wait to talk?

    ListeningGodThe others were older

  5. Who gives understanding to people?

    GodJob's three friendsListening

Word Search

Find and circle each word. Words go across and down.

PEEWAYYCCWLNIEKTNVAILSIALSLIHYDUNKPRTUOOGSVIDESUMJWNRODKNVBENILSNGMERGTDOLDERHUKN
  • SPIRIT
  • ANSWER
  • WISDOM
  • WAITED
  • ELIHU
  • YOUNG
  • OLDER
  • OLD

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you wait for your turn to speak?
  • What can you do when you feel upset with someone?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Grade 3

Young Elihu Speaks

Name Date

Read the Story

So these three men ceased to answer Job, because he was righteous in his own eyes. A young man named Elihu became angry. He was angry with Job and also with the three friends.

Elihu was angry with the friends because they had found no answer, and yet had condemned Job. Elihu had waited to speak to Job, because they were older than he.

Elihu said, Days should speak, and multitude of years should teach wisdom. But there is a spirit in man, and the Spirit of the Almighty gives them understanding. He said, I am full of words. Elihu said some true things about God. But he was also too harsh with Job. God Himself has the final word.

Memory Verse

“But there is a spirit in man, and the Spirit of the Almighty gives them understanding.”

Job 32:8 (WEB)

Answer the Questions

  1. Why did the three men stop answering Job?

  2. Who was Elihu angry with?

  3. Why was Elihu angry with the friends?

  4. Why had Elihu waited?

  5. Who gives understanding?

Elihu Speaks

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

OYPHYOUNGHAWSELIHUWAAOPWOKUONILNIHVLGSTDPSRYWOWEEBDEISYEDRDOIJTWRJNCMDTSIRERJAPIS
  • SPIRIT
  • ANSWER
  • WISDOM
  • WAITED
  • ELIHU
  • YOUNG
  • OLDER
  • OLD

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Elihu say about the aged?
  • What did Elihu promise not to give?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Grade 4

Not Only the Aged Are Wise

Name Date

Read and Think

The three friends stopped answering Job. Then Elihu, a younger man, spoke. His wrath was kindled against Job because Job justified himself rather than God. His wrath was also kindled against the three friends, because they had found no answer, and yet had condemned Job.

Elihu had waited because the others were older. He said, Days should speak, and multitude of years should teach wisdom. But there is a spirit in man, and the Spirit of the Almighty gives them understanding. It is not the great who are wise, nor the aged who understand justice.

Elihu said he had listened carefully, but no one had convinced Job. He said, For I am full of words. He promised not to give flattering titles to any man. Elihu says some true things, but God Himself will have the final word.

Show What You Know

  1. Why was Elihu angry with Job?

  2. Why was Elihu angry with the friends?

  3. What did Elihu say about who is wise?

  4. What did Elihu promise?

Word Bank Fill-In

Use the word bank to fill in each blank.

answerwaitedElihuGodwisdom
  1. Then , a younger man, spoke.
  2. His wrath was kindled against Job because Job justified himself rather than .
  3. His wrath was also kindled against the three friends, because they had found no , and yet had condemned Job.
  4. Elihu had because the others were older.
  5. He said, Days should speak, and multitude of years should teach .

Think About It

  1. Elihu waited respectfully before he spoke. Why is it wise to listen before you speak?

  2. Elihu said the Spirit of the Almighty gives understanding. How can young people grow in wisdom from God?

Memory Verse

“But there is a spirit in man, and the Spirit of the Almighty gives them understanding.”

Job 32:8 (WEB)

Copy It

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be honest instead of just saying nice things?
  • How did Elihu describe himself?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 32 · Grade 5

Full of Words

Name Date

Read and Think

The friends fall silent, because Job is righteous in his own eyes. Elihu, the son of Barachel the Buzite, now speaks. He is angry with Job because he justified himself rather than God. He is angry with the three friends because they had found no answer, and yet had condemned Job. Elihu's point about the friends matches what God will say in 42:7.

Elihu explains why he waited: I said, Days should speak, and multitude of years should teach wisdom. But there is a spirit in man, and the Spirit of the Almighty gives them understanding. It is not the great who are wise, nor the aged who understand justice. Wisdom is a gift from God, not just the result of age.

Elihu says he gave the friends his full attention, but there was no one who convinced Job. I am full of words. The spirit within me constrains me. Behold, my breast is as wine which has no vent. He vows not to flatter anyone, or else my Maker would soon take me away. Elihu's speeches mix true teaching about God with harsh words about Job. God does not mention Elihu in 42:7, but God alone has the final word.

Show What You Know

  1. Why is Elihu angry with Job?

  2. How does Elihu's point about the friends match 42:7?

  3. What does Elihu say about wisdom?

  4. How does Elihu describe himself?

  5. What do Elihu's speeches mix?

Crossword

45312

Across

  1. But there is a ____ in man
  2. because they were ____ than he

Down

  1. Elihu had ____ to speak to Job
  2. I am ____, and you are very old.
  3. The young man who waited to speak

Think About It

  1. Elihu said wisdom comes from God's Spirit, not just age. How can you show respect to older people and still seek wisdom from God?

  2. Elihu was full of words. How can you tell when it is time to speak and when it is time to stay quiet?

Memory Verse

“But there is a spirit in man, and the Spirit of the Almighty gives them understanding.”

Job 32:8 (WEB)

Copy It

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you tell when to speak and when to stay quiet?
  • How can young people grow in wisdom from God?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.