The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 32

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 32 · Grade 2

Elihu Waited

Name Date

Read the Story

Job's three friends stopped talking. They had no more to say.

A young man named Elihu was there. He had been listening. He waited to talk because the others were older.

Elihu said God gives understanding to people. Elihu was full of words. Now it was his turn to talk. Elihu said some true things about God, but God Himself has the final word.

Memory Verse

“Now Elihu had waited to speak to Job, because they were older than he.”

Job 32:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who stopped talking?

    GodJob's three friendsListening

  2. What was the young man's name?

    ElihuThe others were olderListening

  3. What had Elihu been doing?

    Job's three friendsListeningGod

  4. Why did Elihu wait to talk?

    ListeningGodThe others were older

  5. Who gives understanding to people?

    GodJob's three friendsListening

Word Search

Find and circle each word. Words go across and down.

PEEWAYYCCWLNIEKTNVAILSIALSLIHYDUNKPRTUOOGSVIDESUMJWNRODKNVBENILSNGMERGTDOLDERHUKN
  • SPIRIT
  • ANSWER
  • WISDOM
  • WAITED
  • ELIHU
  • YOUNG
  • OLDER
  • OLD

Prayer

Dear God, thank You for giving understanding. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you wait for your turn to speak?
  • What can you do when you feel upset with someone?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.