The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 15

Every grade prints starting on a new page. No answers are included.

Job 15 · Preschool

The Vine and the Olive Tree

Name Date

Color the grapes and the olive tree! God makes good things grow.

Can you find these in the picture? Circle each one!

Bible Verse

“He will shake off his unripe grape as the vine, and will cast off his flower as the olive tree.”

Job 15:33 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Eliphaz talked about grapes and olive trees. Eliphaz thought Job had done wrong, but he was not right. God knows the truth about us.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Kindergarten

Grapes and Trees

Name Date

Trace the Words

Trace each word with your pencil.

VINE
GRAPE
TREE
FLOWER
Are the consolations of God too small for you, even the word that is gentle toward you?

Job 15:11 (WEB)

Match the Pictures

Draw a line from each word to its picture.

GRAPES
TREE
FLOWER
TENT

Mini Maze

Help find the way through the maze.

Draw It

Draw someone speaking gentle words.

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • What grows on a vine?
  • What fruit do you like?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Grade 1

Eliphaz Again

Name Date

Trace the Words

Trace the words and the verse.

GOD
GENTLE
WORD
TRUE
Are the consolations of God too small for you, even the word that is gentle toward you?

Job 15:11 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Eliphaz talked again.
He asked if Job was born before the hills.
He talked about a vine.
He talked about an olive tree.
God's word is gentle.

Eliphaz Speaks Again

Write the number 1 to 4 in each circle to show the right order.

even the word that is gentle toward you

Should a wise man answer with vain knowledge

Are the consolations of God too small for you

Have you heard the secret counsel of God

Draw someone speaking gentle words.

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • Was Eliphaz right about Job?
  • How does God comfort us?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Grade 2

Eliphaz Talks Again

Name Date

Read the Story

Eliphaz talked to Job again. This time he was even harder on Job. He said Job's own words showed he was wrong.

Eliphaz asked if Job was the first man ever born. He asked if Job thought he was the only wise one.

Eliphaz said bad things happen to wicked people. He said they are like a vine that loses its grapes. Eliphaz thought Job was wicked. But he was wrong. God later said the friends did not speak what was right.

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who talked to Job again?

    That he was wrongNo. He was wrongEliphaz

  2. What did Eliphaz say Job's words showed?

    No. He was wrongThat he was wrongEliphaz

  3. What did Eliphaz ask?

  4. What did Eliphaz say wicked people are like?

  5. Was Eliphaz right about Job?

    That he was wrongNo. He was wrongEliphaz

Word Search

Find and circle each word. Words go across and down.

EDIEKNIMWDARKNESSIWKGVWINDSNHRVGDMAEEMPTINESSSRGENTLEMTCOUNSELJTHEAVENSKJWORDFCAY
  • EMPTINESS
  • DARKNESS
  • COUNSEL
  • HEAVENS
  • GENTLE
  • WISE
  • WIND
  • WORD

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be kind when someone asks a hard question?
  • How can you be patient with a friend who is upset?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Grade 3

Are You the First Man?

Name Date

Read the Story

Eliphaz spoke again. He said, Your own mouth condemns you, and not I. He said Job did away with the fear of God.

Eliphaz asked, Are you the first man who was born? Have you heard the secret counsel of God? He asked, Are the consolations of God too small for you, even the word that is gentle toward you?

Eliphaz said the wicked man has a sound of terrors in his ears. He will shake off his unripe grape as the vine, and will cast off his flower as the olive tree. Eliphaz meant that Job was wicked. God later said the friends had not spoken what was right.

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Answer the Questions

  1. What did Eliphaz say condemns Job?

  2. What did Eliphaz say Job did away with?

  3. What did Eliphaz ask about the consolations of God?

  4. What is in the wicked man's ears?

  5. What did God later say about the friends?

Eliphaz Speaks Again

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

GENTLEIPFHEAVENSVLEWINDCNURFAKWORDTMCOUNSELJCDARKNESSKEMPTINESSSLPAMRVMKUIWISEKHE
  • EMPTINESS
  • DARKNESS
  • COUNSEL
  • HEAVENS
  • GENTLE
  • WISE
  • WIND
  • WORD

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep from getting harsher in an argument?
  • How can you comfort someone instead of arguing?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Grade 4

Harder Words

Name Date

Read and Think

In his second speech, Eliphaz was sharper. He said Job's words were like the east wind. Your own mouth condemns you, and not I, he said. He claimed Job was hindering devotion before God.

Eliphaz asked whether Job was the first man born or had heard the secret counsel of God. He said the gray-headed and aged were on the friends' side. He asked whether the consolations of God were too small for Job. Yet Eliphaz's own words had not been gentle.

Eliphaz described the wicked man, who lives in distress and anguish and whose riches do not last. He will shake off his unripe grape as the vine, and cast off his flower as the olive tree. Eliphaz meant this as a warning to Job, but he was wrong about Job. God later said the friends had not spoken what is right.

Show What You Know

  1. What did Eliphaz say condemns Job?

  2. What did Eliphaz ask about God's consolations?

  3. What is ironic about Eliphaz's talk of gentle words?

  4. What did Eliphaz say the wicked man is like?

Think About It

  1. Eliphaz spoke of God's gentle word but was not gentle himself. How can you make your words gentle?

  2. Eliphaz relied on the aged to prove his point. How can you test whether an idea is really true?

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Copy It

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you avoid judging others as proud?
  • How can you calm down when an argument is getting worse?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 15 · Grade 5

The Consolations of God

Name Date

Read and Think

Eliphaz's second speech is sharper than his first. Should a wise man answer with vain knowledge, and fill himself with the east wind? He accuses Job of hindering devotion before God and says, Your own mouth condemns you, and not I. Yes, your own lips testify against you. Eliphaz now treats Job's honest lament as proof of guilt.

Eliphaz challenges Job's wisdom with sarcasm. Are you the first man who was born? Or were you brought out before the hills? Have you heard the secret counsel of God? He points to the gray-headed and very aged men on his side. Then he asks, Are the consolations of God too small for you, even the word that is gentle toward you? The irony is that Eliphaz's own words have not been gentle.

Eliphaz repeats that man is unclean and describes at length the torment of the wicked: a sound of terrors is in his ears, his riches will not continue, and he will shake off his unripe grape as the vine, and will cast off his flower as the olive tree. His portrait of the wicked is meant as a mirror for Job. But the mirror is false. In Job 42:7 God says the friends have not spoken of Him the thing that is right.

Show What You Know

  1. How does Eliphaz now treat Job's lament?

  2. What sarcastic questions does Eliphaz ask about Job's wisdom?

  3. What is ironic about Eliphaz's question about God's gentle word?

  4. How does Eliphaz describe the wicked?

  5. Why is Eliphaz's mirror for Job false?

Crossword

4132

Across

  1. even the word that is ____ toward you
  2. Should a ____ man answer with vain knowledge

Down

  1. Have you heard the secret ____ of God
  2. He spoke to Job a second time.
  3. fill himself with the east ____

Think About It

  1. Eliphaz used tradition and age to silence Job. How can respect for elders be balanced with listening to someone's honest pain?

  2. God's consolations are real and gentle. How have you experienced God's comfort?

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Copy It

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you talk with a hurting friend about them, not about others?
  • How can we offer God's gentle comfort to others?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.