The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 15

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 15 · Grade 2

Eliphaz Talks Again

Name Date

Read the Story

Eliphaz talked to Job again. This time he was even harder on Job. He said Job's own words showed he was wrong.

Eliphaz asked if Job was the first man ever born. He asked if Job thought he was the only wise one.

Eliphaz said bad things happen to wicked people. He said they are like a vine that loses its grapes. Eliphaz thought Job was wicked. But he was wrong. God later said the friends did not speak what was right.

Memory Verse

“Are the consolations of God too small for you, even the word that is gentle toward you?”

Job 15:11 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who talked to Job again?

    That he was wrongNo. He was wrongEliphaz

  2. What did Eliphaz say Job's words showed?

    No. He was wrongThat he was wrongEliphaz

  3. What did Eliphaz ask?

  4. What did Eliphaz say wicked people are like?

  5. Was Eliphaz right about Job?

    That he was wrongNo. He was wrongEliphaz

Word Search

Find and circle each word. Words go across and down.

EDIEKNIMWDARKNESSIWKGVWINDSNHRVGDMAEEMPTINESSSRGENTLEMTCOUNSELJTHEAVENSKJWORDFCAY
  • EMPTINESS
  • DARKNESS
  • COUNSEL
  • HEAVENS
  • GENTLE
  • WISE
  • WIND
  • WORD

Prayer

Dear God, thank You for words that are gentle. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you be kind when someone asks a hard question?
  • How can you be patient with a friend who is upset?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.